Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | AOD60_RS26245 | Genome accession | NZ_CP012721 |
| Coordinates | 4872983..4873564 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049158.1 | Uniprot ID | - |
| Organism | Bacillus anthracis strain PR02 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4826652..4873564 | 4872983..4873564 | within | 0 |
Gene organization within MGE regions
Location: 4826652..4873564
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AOD60_RS25965 (AOD60_25970) | speG | 4826652..4827167 (-) | 516 | WP_000076824.1 | spermidine N1-acetyltransferase | - |
| AOD60_RS25970 (AOD60_25975) | psiE | 4827311..4827715 (-) | 405 | WP_000834704.1 | phosphate-starvation-inducible protein PsiE | - |
| AOD60_RS25975 (AOD60_25980) | - | 4827765..4828727 (-) | 963 | WP_000635749.1 | nuclease-related domain-containing protein | - |
| AOD60_RS25980 (AOD60_25985) | - | 4829163..4830128 (+) | 966 | WP_001036602.1 | DUF4822 domain-containing protein | - |
| AOD60_RS25985 (AOD60_25990) | - | 4830353..4831105 (-) | 753 | WP_000590068.1 | siderophore ABC transporter ATP-binding protein | - |
| AOD60_RS25990 (AOD60_25995) | - | 4831102..4832166 (-) | 1065 | WP_000631132.1 | iron chelate uptake ABC transporter family permease subunit | - |
| AOD60_RS25995 (AOD60_26000) | - | 4832163..4833179 (-) | 1017 | WP_000042061.1 | ABC transporter permease | - |
| AOD60_RS26000 (AOD60_26005) | - | 4833199..4834212 (-) | 1014 | WP_000753441.1 | siderophore ABC transporter substrate-binding protein | - |
| AOD60_RS26005 (AOD60_26010) | - | 4834627..4835304 (-) | 678 | WP_001250248.1 | response regulator transcription factor | - |
| AOD60_RS26015 (AOD60_26015) | smpB | 4836193..4836660 (-) | 468 | WP_001123905.1 | SsrA-binding protein | - |
| AOD60_RS26020 (AOD60_26020) | rnr | 4836909..4839335 (-) | 2427 | WP_000391091.1 | ribonuclease R | - |
| AOD60_RS26025 (AOD60_26025) | estA | 4839478..4840218 (-) | 741 | WP_000761977.1 | carboxylesterase | - |
| AOD60_RS26030 (AOD60_26030) | secG | 4840380..4840613 (-) | 234 | WP_000557262.1 | preprotein translocase subunit SecG | - |
| AOD60_RS26035 (AOD60_26035) | - | 4840708..4841400 (-) | 693 | WP_000078306.1 | LrgB family protein | - |
| AOD60_RS26040 (AOD60_26040) | - | 4841397..4841765 (-) | 369 | WP_000673222.1 | CidA/LrgA family holin-like protein | - |
| AOD60_RS26045 (AOD60_26045) | - | 4842041..4842991 (+) | 951 | WP_001125043.1 | nucleoside hydrolase | - |
| AOD60_RS30910 | - | 4843043..4843156 (-) | 114 | Protein_4991 | hypothetical protein | - |
| AOD60_RS26050 (AOD60_26050) | - | 4843480..4843992 (-) | 513 | WP_000422852.1 | hypothetical protein | - |
| AOD60_RS26055 (AOD60_26055) | - | 4844150..4844608 (-) | 459 | WP_000711928.1 | hypothetical protein | - |
| AOD60_RS26065 (AOD60_26065) | - | 4845025..4845834 (-) | 810 | WP_000639551.1 | NUMOD4 domain-containing protein | - |
| AOD60_RS26070 (AOD60_26070) | - | 4846009..4846638 (-) | 630 | WP_000142503.1 | hypothetical protein | - |
| AOD60_RS26075 (AOD60_26075) | - | 4846826..4847176 (-) | 351 | WP_000817546.1 | DUF2513 domain-containing protein | - |
| AOD60_RS26080 (AOD60_26080) | - | 4847321..4847797 (+) | 477 | WP_001003949.1 | hypothetical protein | - |
| AOD60_RS30550 (AOD60_26085) | - | 4847863..4848039 (-) | 177 | WP_000664412.1 | hypothetical protein | - |
| AOD60_RS26090 (AOD60_26090) | - | 4848036..4848248 (-) | 213 | WP_000660592.1 | hypothetical protein | - |
| AOD60_RS26095 (AOD60_26095) | - | 4848254..4848499 (-) | 246 | WP_001008127.1 | helix-turn-helix transcriptional regulator | - |
| AOD60_RS26100 (AOD60_26100) | - | 4848496..4848741 (-) | 246 | WP_000823894.1 | hypothetical protein | - |
| AOD60_RS26105 (AOD60_26105) | - | 4848894..4849097 (+) | 204 | WP_000502531.1 | hypothetical protein | - |
| AOD60_RS26110 (AOD60_26110) | - | 4849116..4849853 (+) | 738 | WP_000811954.1 | hypothetical protein | - |
| AOD60_RS26115 (AOD60_26115) | - | 4850264..4850455 (+) | 192 | WP_001001289.1 | hypothetical protein | - |
| AOD60_RS26120 (AOD60_26120) | - | 4850552..4851139 (+) | 588 | WP_000900865.1 | hypothetical protein | - |
| AOD60_RS26125 (AOD60_26125) | - | 4851132..4852703 (+) | 1572 | WP_003159006.1 | terminase TerL endonuclease subunit | - |
| AOD60_RS30915 (AOD60_26130) | - | 4852854..4853246 (+) | 393 | WP_223849890.1 | HNH endonuclease | - |
| AOD60_RS26135 (AOD60_26135) | - | 4853663..4854973 (+) | 1311 | WP_000522484.1 | phage portal protein | - |
| AOD60_RS26140 (AOD60_26140) | - | 4854945..4855442 (+) | 498 | WP_003159003.1 | HK97 family phage prohead protease | - |
| AOD60_RS26145 (AOD60_26145) | - | 4855502..4856542 (+) | 1041 | WP_003159030.1 | phage major capsid protein | - |
| AOD60_RS26150 (AOD60_26150) | - | 4856629..4857609 (+) | 981 | WP_000168836.1 | phage major capsid protein | - |
| AOD60_RS26155 (AOD60_26155) | - | 4857677..4858543 (-) | 867 | WP_000348695.1 | hypothetical protein | - |
| AOD60_RS26160 (AOD60_26160) | - | 4858666..4859571 (-) | 906 | WP_000910235.1 | tyrosine-type recombinase/integrase | - |
| AOD60_RS26165 (AOD60_26165) | eno | 4859715..4861010 (-) | 1296 | WP_000103949.1 | phosphopyruvate hydratase | - |
| AOD60_RS26170 (AOD60_26170) | gpmI | 4861041..4862570 (-) | 1530 | WP_001231153.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| AOD60_RS26175 (AOD60_26175) | tpiA | 4862567..4863322 (-) | 756 | WP_001231039.1 | triose-phosphate isomerase | - |
| AOD60_RS26180 (AOD60_26180) | - | 4863355..4864539 (-) | 1185 | WP_001036337.1 | phosphoglycerate kinase | - |
| AOD60_RS26185 (AOD60_26185) | gap | 4864679..4865683 (-) | 1005 | WP_000161236.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| AOD60_RS26190 (AOD60_26190) | cggR | 4865710..4866738 (-) | 1029 | WP_001258187.1 | gapA transcriptional regulator CggR | - |
| AOD60_RS26195 (AOD60_26195) | - | 4866875..4867120 (-) | 246 | WP_000869728.1 | glutaredoxin family protein | - |
| AOD60_RS26200 (AOD60_26200) | rpoN | 4867130..4868437 (-) | 1308 | WP_000647981.1 | RNA polymerase factor sigma-54 | - |
| AOD60_RS26210 (AOD60_26210) | - | 4868977..4869183 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| AOD60_RS26215 (AOD60_26215) | - | 4869277..4869762 (+) | 486 | WP_001228539.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| AOD60_RS26220 (AOD60_26220) | spoVAC | 4869793..4870269 (+) | 477 | WP_000095399.1 | stage V sporulation protein AC | - |
| AOD60_RS26225 (AOD60_26225) | spoVAD | 4870270..4871286 (+) | 1017 | WP_000938967.1 | stage V sporulation protein AD | - |
| AOD60_RS26230 (AOD60_26230) | spoVAE | 4871283..4871633 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| AOD60_RS26235 (AOD60_26235) | - | 4871645..4871851 (+) | 207 | WP_000215915.1 | DUF1657 domain-containing protein | - |
| AOD60_RS26240 (AOD60_26240) | - | 4871872..4872741 (+) | 870 | WP_000018934.1 | DUF421 domain-containing protein | - |
| AOD60_RS26245 (AOD60_26245) | clpP | 4872983..4873564 (+) | 582 | WP_001049158.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21391.62 Da Isoelectric Point: 5.0423
>NTDB_id=156896 AOD60_RS26245 WP_001049158.1 4872983..4873564(+) (clpP) [Bacillus anthracis strain PR02]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=156896 AOD60_RS26245 WP_001049158.1 4872983..4873564(+) (clpP) [Bacillus anthracis strain PR02]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
89.583 |
99.482 |
0.891 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |