Detailed information NTG0155647

Bioinformatically predicted

Overview

• Name: prx
• Type: Regulator
• Locus tag: AMD33_RS10910
• Genome accession: NZ_CP012588
• Coordinates: 542504..542665 (-)
• Length: 53 a.a.
• NCBI ID: WP_014727422.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain MN-BM-A01
• Function: Inhibit ComR activation (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	534684..550418	542504..542665	within	0

Gene organization within MGE regions

Location: 534684..550418

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AMD33_RS02770 (AMD33_02765)	dltD	534684..535952 (+)	1269	WP_011681024.1	D-alanyl-lipoteichoic acid biosynthesis protein DltD	-
AMD33_RS10905	-	536005..537354 (-)	1350	Protein_544	IS3 family transposase	-
AMD33_RS02800 (AMD33_02795)	-	537553..540189 (-)	2637	WP_014727421.1	calcium-translocating P-type ATPase, PMCA-type	-
AMD33_RS02805 (AMD33_02800)	pabB	540366..542084 (-)	1719	WP_014608193.1	aminodeoxychorismate synthase component I	-
AMD33_RS10910	prx	542504..542665 (-)	162	WP_014727422.1	hypothetical protein	Regulator
AMD33_RS02815 (AMD33_02810)	-	543149..543424 (-)	276	WP_014727423.1	hypothetical protein	-
AMD33_RS02820 (AMD33_02815)	-	543441..543623 (-)	183	WP_014727424.1	hypothetical protein	-
AMD33_RS02825 (AMD33_02820)	-	543952..545025 (-)	1074	WP_014727425.1	VapE domain-containing protein	-
AMD33_RS02835 (AMD33_02830)	-	545360..546217 (-)	858	WP_014727426.1	primase alpha helix C-terminal domain-containing protein	-
AMD33_RS02840 (AMD33_02835)	-	546232..546504 (-)	273	WP_011227098.1	MerR family transcriptional regulator	-
AMD33_RS02845 (AMD33_02840)	-	546506..546847 (-)	342	WP_224102964.1	hypothetical protein	-
AMD33_RS02850 (AMD33_02845)	-	546834..547070 (-)	237	WP_014727428.1	hypothetical protein	-
AMD33_RS02855 (AMD33_02850)	-	547084..547278 (-)	195	WP_014727429.1	hypothetical protein	-
AMD33_RS02860 (AMD33_02855)	-	547282..547587 (-)	306	WP_014727430.1	hypothetical protein	-
AMD33_RS02865 (AMD33_02860)	-	547807..548004 (-)	198	WP_014727431.1	helix-turn-helix domain-containing protein	-
AMD33_RS02870 (AMD33_02865)	-	548167..548685 (+)	519	WP_002948197.1	helix-turn-helix transcriptional regulator	-
AMD33_RS02875 (AMD33_02870)	-	548801..549967 (+)	1167	WP_014727432.1	tyrosine-type recombinase/integrase	-
AMD33_RS02880 (AMD33_02875)	-	550083..550418 (+)	336	WP_011225805.1	hypothetical protein	-

Sequence

Protein

• Length: 53 a.a.
• Molecular weight: 6084.95 Da
• Isoelectric Point: 4.2412

>NTDB_id=155647 AMD33_RS10910 WP_014727422.1 542504..542665(-) (prx) [Streptococcus thermophilus strain MN-BM-A01]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN

Nucleotide

• Length: 162 bp

>NTDB_id=155647 AMD33_RS10910 WP_014727422.1 542504..542665(-) (prx) [Streptococcus thermophilus strain MN-BM-A01]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
prx	Streptococcus pyogenes MGAS8232	48.333	100	0.547
prx	Streptococcus pyogenes MGAS315	46.667	100	0.528
prx	Streptococcus pyogenes MGAS315	46.667	100	0.528
prx	Streptococcus pyogenes MGAS315	45	100	0.509
prx	Streptococcus pyogenes MGAS315	56.818	83.019	0.472
prx	Streptococcus pyogenes MGAS315	57.143	79.245	0.453
prx	Streptococcus pyogenes MGAS315	60.526	71.698	0.434