Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AMR84_RS11010 | Genome accession | NZ_CP012503 |
| Coordinates | 603527..603715 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain NGBS357 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 596672..657052 | 603527..603715 | within | 0 |
| IS/Tn | 602481..603092 | 603527..603715 | flank | 435 |
Gene organization within MGE regions
Location: 596672..657052
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AMR84_RS03355 (AMR84_03350) | - | 597062..598339 (+) | 1278 | WP_000594366.1 | ABC transporter permease | - |
| AMR84_RS03360 (AMR84_03355) | - | 598349..599005 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| AMR84_RS03365 (AMR84_03360) | - | 599005..600381 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| AMR84_RS03370 (AMR84_03365) | - | 600478..601131 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| AMR84_RS03375 (AMR84_03370) | - | 601128..602429 (+) | 1302 | WP_000734168.1 | sensor histidine kinase | - |
| AMR84_RS03380 (AMR84_03375) | - | 602481..603128 (-) | 648 | Protein_595 | IS3 family transposase | - |
| AMR84_RS03385 (AMR84_03380) | - | 603306..603485 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| AMR84_RS11010 | prx | 603527..603715 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| AMR84_RS03390 (AMR84_03385) | - | 604140..605345 (+) | 1206 | WP_000078931.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| AMR84_RS03395 (AMR84_03390) | - | 605464..606024 (+) | 561 | WP_001106189.1 | HAD-IA family hydrolase | - |
| AMR84_RS03400 (AMR84_03395) | gyrB | 606025..607977 (+) | 1953 | WP_000134196.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| AMR84_RS03405 (AMR84_03400) | ezrA | 608071..609795 (+) | 1725 | WP_000094336.1 | septation ring formation regulator EzrA | - |
| AMR84_RS03410 (AMR84_03405) | serB | 609889..610530 (+) | 642 | WP_000589685.1 | phosphoserine phosphatase SerB | - |
| AMR84_RS03415 (AMR84_03410) | - | 610551..611036 (-) | 486 | WP_000409124.1 | NUDIX hydrolase | - |
| AMR84_RS03420 (AMR84_03415) | - | 611049..611504 (-) | 456 | WP_000137374.1 | YueI family protein | - |
| AMR84_RS03425 (AMR84_03420) | eno | 611702..613009 (+) | 1308 | WP_000022830.1 | surface-displayed alpha-enolase | - |
| AMR84_RS03430 (AMR84_03425) | - | 613117..614181 (-) | 1065 | WP_000823922.1 | DNA/RNA non-specific endonuclease | - |
| AMR84_RS03435 (AMR84_03430) | aroA | 614410..615693 (+) | 1284 | WP_000772013.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| AMR84_RS03440 (AMR84_03435) | - | 615686..616198 (+) | 513 | WP_001127193.1 | shikimate kinase | - |
| AMR84_RS03445 (AMR84_03440) | - | 616255..617628 (+) | 1374 | WP_000089337.1 | LCP family protein | - |
| AMR84_RS03450 (AMR84_03445) | rlmD | 617729..619090 (+) | 1362 | WP_029140953.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| AMR84_RS11490 | - | 619087..619245 (+) | 159 | WP_000697423.1 | hypothetical protein | - |
| AMR84_RS03455 (AMR84_03450) | - | 619252..619533 (+) | 282 | WP_001267198.1 | CD1845 family protein | - |
| AMR84_RS03460 (AMR84_03455) | - | 619624..620394 (+) | 771 | WP_000344984.1 | replication initiator protein A | - |
| AMR84_RS03465 (AMR84_03460) | - | 620391..621242 (+) | 852 | WP_000588833.1 | ATP-binding protein | - |
| AMR84_RS03470 (AMR84_03465) | - | 621239..621724 (+) | 486 | WP_069029893.1 | PcfB family protein | - |
| AMR84_RS03475 (AMR84_03470) | - | 621721..623505 (+) | 1785 | WP_069029894.1 | VirD4-like conjugal transfer protein, CD1115 family | - |
| AMR84_RS11810 | - | 623559..623690 (+) | 132 | WP_257784603.1 | hypothetical protein | - |
| AMR84_RS03480 (AMR84_03475) | - | 623671..623982 (+) | 312 | WP_000807042.1 | single-stranded DNA-binding protein | - |
| AMR84_RS11015 | - | 623986..624114 (+) | 129 | Protein_619 | Maff2 family mobile element protein | - |
| AMR84_RS03485 (AMR84_03480) | ltrA | 624839..626722 (+) | 1884 | WP_017646160.1 | group II intron reverse transcriptase/maturase | - |
| AMR84_RS11020 | - | 626874..626972 (+) | 99 | Protein_621 | Maff2 family mobile element protein | - |
| AMR84_RS03490 (AMR84_03485) | - | 626992..627855 (+) | 864 | WP_069029895.1 | VirB6/TrbL-like conjugal transfer protein, CD1112 family | - |
| AMR84_RS03495 (AMR84_03490) | - | 627873..628136 (+) | 264 | WP_069029896.1 | conjugal transfer protein | - |
| AMR84_RS03500 (AMR84_03495) | - | 628140..628529 (+) | 390 | WP_055328036.1 | PrgI family protein | - |
| AMR84_RS03505 (AMR84_03500) | - | 628441..630870 (+) | 2430 | WP_069029897.1 | VirB4-like conjugal transfer ATPase, CD1110 family | - |
| AMR84_RS03510 (AMR84_03505) | - | 630875..633007 (+) | 2133 | WP_069029898.1 | CHAP domain-containing protein | - |
| AMR84_RS03515 (AMR84_03510) | - | 633020..633256 (+) | 237 | WP_000711923.1 | hypothetical protein | - |
| AMR84_RS03520 (AMR84_03515) | - | 633234..635420 (+) | 2187 | WP_069029899.1 | CD1107 family mobile element protein | - |
| AMR84_RS03525 (AMR84_03520) | - | 635518..637224 (+) | 1707 | WP_069029900.1 | DNA topoisomerase 3 | - |
| AMR84_RS03530 (AMR84_03525) | - | 637306..638841 (+) | 1536 | WP_068914297.1 | helix-turn-helix domain-containing protein | - |
| AMR84_RS03535 (AMR84_03530) | - | 638924..647680 (+) | 8757 | WP_069029901.1 | helicase-related protein | - |
| AMR84_RS03540 (AMR84_03535) | - | 647723..648382 (+) | 660 | WP_069029902.1 | DNA-binding protein | - |
| AMR84_RS03545 (AMR84_03540) | - | 648493..648714 (+) | 222 | WP_069029933.1 | helix-turn-helix domain-containing protein | - |
| AMR84_RS03550 (AMR84_03545) | - | 648811..649584 (+) | 774 | WP_069029903.1 | ABC transporter ATP-binding protein | - |
| AMR84_RS03555 (AMR84_03550) | - | 649574..651628 (+) | 2055 | WP_069029904.1 | FtsX-like permease family protein | - |
| AMR84_RS03560 (AMR84_03555) | - | 651661..652344 (+) | 684 | WP_028078671.1 | response regulator transcription factor | - |
| AMR84_RS03565 (AMR84_03560) | - | 652334..653332 (+) | 999 | WP_028078670.1 | sensor histidine kinase | - |
| AMR84_RS03570 (AMR84_03565) | - | 653364..654695 (-) | 1332 | WP_069029905.1 | relaxase/mobilization nuclease domain-containing protein | - |
| AMR84_RS03575 (AMR84_03570) | - | 654698..655054 (-) | 357 | WP_019107292.1 | plasmid mobilization protein | - |
| AMR84_RS03580 (AMR84_03575) | - | 655468..656745 (+) | 1278 | WP_047212290.1 | IS110 family transposase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=154817 AMR84_RS11010 WP_000027835.1 603527..603715(+) (prx) [Streptococcus agalactiae strain NGBS357]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=154817 AMR84_RS11010 WP_000027835.1 603527..603715(+) (prx) [Streptococcus agalactiae strain NGBS357]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |