Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AMR84_RS03145 | Genome accession | NZ_CP012503 |
| Coordinates | 553692..553871 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain NGBS357 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 513091..555450 | 553692..553871 | within | 0 |
Gene organization within MGE regions
Location: 513091..555450
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AMR84_RS02885 (AMR84_02880) | - | 513109..513948 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| AMR84_RS02890 (AMR84_02885) | - | 513923..514525 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| AMR84_RS02895 (AMR84_02890) | - | 514628..514903 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| AMR84_RS02900 (AMR84_02895) | - | 514991..516133 (-) | 1143 | WP_000269472.1 | tyrosine-type recombinase/integrase | - |
| AMR84_RS02905 (AMR84_02900) | - | 516248..516799 (-) | 552 | WP_000353930.1 | hypothetical protein | - |
| AMR84_RS02910 (AMR84_02905) | - | 516817..517203 (-) | 387 | WP_000151182.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AMR84_RS02915 (AMR84_02910) | - | 517207..517554 (-) | 348 | WP_000484457.1 | helix-turn-helix domain-containing protein | - |
| AMR84_RS02920 (AMR84_02915) | - | 517850..518095 (+) | 246 | WP_000739596.1 | hypothetical protein | - |
| AMR84_RS02925 (AMR84_02920) | - | 518046..518834 (-) | 789 | WP_000092750.1 | hypothetical protein | - |
| AMR84_RS02930 (AMR84_02925) | - | 518885..519076 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| AMR84_RS02935 (AMR84_02930) | - | 519156..519467 (+) | 312 | WP_001123482.1 | hypothetical protein | - |
| AMR84_RS11590 | - | 519472..519621 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| AMR84_RS02940 (AMR84_02935) | - | 519615..519842 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| AMR84_RS02945 (AMR84_02940) | - | 519835..520065 (+) | 231 | WP_000573547.1 | hypothetical protein | - |
| AMR84_RS02950 (AMR84_02945) | - | 520049..521368 (+) | 1320 | WP_000156426.1 | AAA family ATPase | - |
| AMR84_RS02955 (AMR84_02950) | - | 521383..522456 (+) | 1074 | WP_001167564.1 | ATP-binding protein | - |
| AMR84_RS02960 (AMR84_02955) | - | 522552..523157 (+) | 606 | WP_000141564.1 | hypothetical protein | - |
| AMR84_RS02965 (AMR84_02960) | - | 523157..523765 (+) | 609 | WP_001870729.1 | hypothetical protein | - |
| AMR84_RS02970 (AMR84_02965) | - | 523771..525354 (+) | 1584 | WP_032456395.1 | DEAD/DEAH box helicase | - |
| AMR84_RS02975 (AMR84_02970) | - | 525363..525560 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| AMR84_RS02980 (AMR84_02975) | - | 525553..525804 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| AMR84_RS02985 (AMR84_02980) | - | 525875..528154 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| AMR84_RS02990 (AMR84_02985) | - | 528524..528721 (+) | 198 | WP_000666342.1 | crAss001_48 related protein | - |
| AMR84_RS02995 (AMR84_02990) | - | 528748..529146 (+) | 399 | WP_000151204.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AMR84_RS03000 (AMR84_02995) | - | 529143..529358 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| AMR84_RS03005 (AMR84_03000) | - | 529355..529591 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| AMR84_RS03010 (AMR84_03005) | - | 529588..529818 (+) | 231 | WP_001005355.1 | hypothetical protein | - |
| AMR84_RS03015 (AMR84_03010) | - | 529821..530153 (+) | 333 | WP_000052302.1 | hypothetical protein | - |
| AMR84_RS03020 (AMR84_03015) | - | 530231..530644 (+) | 414 | WP_000041038.1 | transcriptional regulator | - |
| AMR84_RS03025 (AMR84_03020) | - | 530765..531196 (+) | 432 | WP_000041103.1 | terminase small subunit | - |
| AMR84_RS03030 (AMR84_03025) | - | 531186..532466 (+) | 1281 | WP_000208745.1 | PBSX family phage terminase large subunit | - |
| AMR84_RS03035 (AMR84_03030) | - | 532544..534010 (+) | 1467 | WP_370657591.1 | phage portal protein | - |
| AMR84_RS03040 (AMR84_03035) | - | 533970..535418 (+) | 1449 | WP_032459253.1 | phage head morphogenesis protein | - |
| AMR84_RS11855 (AMR84_03040) | - | 535446..535634 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| AMR84_RS03050 (AMR84_03045) | - | 535639..535842 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| AMR84_RS03055 (AMR84_03050) | - | 535985..536554 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| AMR84_RS11595 (AMR84_03055) | - | 536573..537469 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| AMR84_RS03065 (AMR84_03060) | - | 537475..537831 (+) | 357 | WP_000356705.1 | phage head-tail connector protein | - |
| AMR84_RS03070 (AMR84_03065) | - | 537842..538120 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| AMR84_RS03075 (AMR84_03070) | - | 538117..538461 (+) | 345 | WP_000060408.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AMR84_RS03080 (AMR84_03075) | - | 538465..538824 (+) | 360 | WP_000640604.1 | hypothetical protein | - |
| AMR84_RS03085 (AMR84_03080) | - | 538836..539468 (+) | 633 | WP_000450517.1 | phage major tail protein, TP901-1 family | - |
| AMR84_RS03090 (AMR84_03085) | - | 539519..539974 (+) | 456 | WP_000424190.1 | tail assembly chaperone | - |
| AMR84_RS03095 (AMR84_03090) | - | 540049..540279 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| AMR84_RS03100 (AMR84_03095) | - | 540308..544534 (+) | 4227 | WP_069029892.1 | tape measure protein | - |
| AMR84_RS03105 (AMR84_03100) | - | 544547..545389 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| AMR84_RS03110 (AMR84_03105) | - | 545402..549229 (+) | 3828 | WP_000206522.1 | phage tail protein | - |
| AMR84_RS11600 | - | 549238..549390 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| AMR84_RS03115 (AMR84_03110) | - | 549401..549817 (+) | 417 | WP_001873936.1 | DUF1366 domain-containing protein | - |
| AMR84_RS11605 | - | 549880..550041 (+) | 162 | WP_000222556.1 | hypothetical protein | - |
| AMR84_RS03120 (AMR84_03115) | - | 550051..550347 (+) | 297 | WP_000564987.1 | hypothetical protein | - |
| AMR84_RS03125 (AMR84_03120) | - | 550349..550687 (+) | 339 | WP_001001962.1 | phage holin | - |
| AMR84_RS03130 (AMR84_03125) | - | 550689..551408 (+) | 720 | WP_000236382.1 | peptidoglycan amidohydrolase family protein | - |
| AMR84_RS03135 (AMR84_03130) | - | 551747..552706 (+) | 960 | WP_000829578.1 | Abi family protein | - |
| AMR84_RS03140 (AMR84_03135) | - | 552861..553061 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| AMR84_RS10990 | - | 553102..553272 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| AMR84_RS11805 | - | 553408..553533 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| AMR84_RS03145 (AMR84_03140) | prx | 553692..553871 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| AMR84_RS03150 (AMR84_03145) | - | 554277..554474 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| AMR84_RS03155 (AMR84_03150) | - | 554518..555450 (-) | 933 | WP_000254060.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=154787 AMR84_RS03145 WP_000965651.1 553692..553871(+) (prx) [Streptococcus agalactiae strain NGBS357]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=154787 AMR84_RS03145 WP_000965651.1 553692..553871(+) (prx) [Streptococcus agalactiae strain NGBS357]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |