Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | AKO66_RS03535 | Genome accession | NZ_CP012330 |
| Coordinates | 714073..714669 (-) | Length | 198 a.a. |
| NCBI ID | WP_007500118.1 | Uniprot ID | - |
| Organism | Bacillus altitudinis strain NJ-V | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 714073..755190 | 714073..714669 | within | 0 |
Gene organization within MGE regions
Location: 714073..755190
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AKO66_RS03535 (AKO66_03525) | clpP | 714073..714669 (-) | 597 | WP_007500118.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| AKO66_RS03545 (AKO66_03535) | - | 715157..716266 (-) | 1110 | WP_057079015.1 | tyrosine-type recombinase/integrase | - |
| AKO66_RS03550 (AKO66_03540) | - | 716490..717578 (+) | 1089 | WP_057079016.1 | AimR family lysis-lysogeny pheromone receptor | - |
| AKO66_RS03555 (AKO66_03545) | - | 718004..718396 (-) | 393 | WP_057079017.1 | helix-turn-helix domain-containing protein | - |
| AKO66_RS03560 (AKO66_03550) | - | 718560..718766 (+) | 207 | WP_057079018.1 | helix-turn-helix domain-containing protein | - |
| AKO66_RS03565 (AKO66_03555) | - | 718803..719129 (+) | 327 | WP_081038980.1 | DUF771 domain-containing protein | - |
| AKO66_RS03570 (AKO66_03560) | - | 719162..720013 (+) | 852 | WP_057079020.1 | conserved phage C-terminal domain-containing protein | - |
| AKO66_RS03575 (AKO66_03565) | - | 719952..720818 (+) | 867 | WP_234781024.1 | AAA family ATPase | - |
| AKO66_RS19925 | - | 720927..721082 (+) | 156 | WP_164071250.1 | DUF6906 family protein | - |
| AKO66_RS03580 (AKO66_03570) | - | 721079..721609 (+) | 531 | WP_057079022.1 | hypothetical protein | - |
| AKO66_RS19805 | - | 721661..721795 (+) | 135 | WP_117590493.1 | BH0509 family protein | - |
| AKO66_RS19930 | - | 721802..721984 (+) | 183 | WP_234781026.1 | hypothetical protein | - |
| AKO66_RS03585 (AKO66_03575) | - | 722054..722263 (+) | 210 | WP_057079023.1 | XtrA/YqaO family protein | - |
| AKO66_RS03590 (AKO66_03580) | - | 722297..722548 (+) | 252 | WP_057079024.1 | hypothetical protein | - |
| AKO66_RS03595 (AKO66_03585) | - | 722577..723317 (+) | 741 | WP_057079025.1 | hypothetical protein | - |
| AKO66_RS19935 | - | 723328..723504 (+) | 177 | WP_164071252.1 | hypothetical protein | - |
| AKO66_RS19400 | - | 723501..723980 (+) | 480 | WP_081038944.1 | hypothetical protein | - |
| AKO66_RS03605 (AKO66_03600) | - | 723996..724268 (+) | 273 | WP_057079026.1 | hypothetical protein | - |
| AKO66_RS03610 (AKO66_03605) | - | 724265..724675 (+) | 411 | WP_057079027.1 | hypothetical protein | - |
| AKO66_RS03615 (AKO66_03610) | - | 724882..725784 (+) | 903 | WP_057079028.1 | hypothetical protein | - |
| AKO66_RS20225 | - | 725887..726009 (+) | 123 | WP_268761895.1 | hypothetical protein | - |
| AKO66_RS03620 (AKO66_03615) | - | 726023..726469 (+) | 447 | WP_057079029.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AKO66_RS03625 (AKO66_03620) | - | 726466..727008 (+) | 543 | WP_057079030.1 | site-specific integrase | - |
| AKO66_RS03630 (AKO66_03625) | - | 727335..727811 (+) | 477 | WP_057079031.1 | hypothetical protein | - |
| AKO66_RS03635 (AKO66_03630) | - | 728135..728416 (+) | 282 | WP_057079032.1 | hypothetical protein | - |
| AKO66_RS03640 (AKO66_03635) | - | 728611..729825 (+) | 1215 | WP_057079033.1 | PIN-like domain-containing protein | - |
| AKO66_RS03645 (AKO66_03640) | - | 729910..730266 (+) | 357 | WP_057079034.1 | hypothetical protein | - |
| AKO66_RS03650 (AKO66_03645) | - | 730256..730621 (+) | 366 | WP_057079035.1 | HNH endonuclease | - |
| AKO66_RS03660 (AKO66_03655) | - | 730849..731367 (+) | 519 | WP_057079037.1 | phage terminase small subunit P27 family | - |
| AKO66_RS03665 (AKO66_03660) | - | 731364..733073 (+) | 1710 | WP_057079038.1 | terminase large subunit | - |
| AKO66_RS03670 (AKO66_03665) | - | 733089..733283 (+) | 195 | WP_025094076.1 | hypothetical protein | - |
| AKO66_RS03675 (AKO66_03670) | - | 733280..734581 (+) | 1302 | WP_034667988.1 | phage portal protein | - |
| AKO66_RS03680 (AKO66_03675) | - | 734538..735254 (+) | 717 | WP_057079039.1 | head maturation protease, ClpP-related | - |
| AKO66_RS03685 (AKO66_03680) | - | 735359..736558 (+) | 1200 | WP_057079794.1 | phage major capsid protein | - |
| AKO66_RS03690 (AKO66_03685) | - | 736586..736984 (+) | 399 | WP_057079040.1 | collagen-like protein | - |
| AKO66_RS03695 (AKO66_03690) | - | 736997..737305 (+) | 309 | WP_057079041.1 | head-tail connector protein | - |
| AKO66_RS03700 (AKO66_03695) | - | 737295..737609 (+) | 315 | WP_057079042.1 | phage head closure protein | - |
| AKO66_RS03705 (AKO66_03700) | - | 737609..738013 (+) | 405 | WP_025094083.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AKO66_RS03710 (AKO66_03705) | - | 738010..738408 (+) | 399 | WP_057079043.1 | DUF3168 domain-containing protein | - |
| AKO66_RS03715 (AKO66_03710) | - | 738411..739025 (+) | 615 | WP_057079044.1 | major tail protein | - |
| AKO66_RS03720 (AKO66_03715) | gpG | 739082..739426 (+) | 345 | WP_057079045.1 | phage tail assembly chaperone G | - |
| AKO66_RS03725 (AKO66_03720) | - | 739639..744084 (+) | 4446 | WP_057079046.1 | phage tail tape measure protein | - |
| AKO66_RS03730 (AKO66_03725) | - | 744085..744921 (+) | 837 | WP_057079047.1 | phage tail domain-containing protein | - |
| AKO66_RS03735 (AKO66_03730) | - | 744933..746687 (+) | 1755 | WP_057079048.1 | phage tail protein | - |
| AKO66_RS03740 (AKO66_03735) | - | 746725..748599 (+) | 1875 | WP_057079049.1 | right-handed parallel beta-helix repeat-containing protein | - |
| AKO66_RS03745 (AKO66_03740) | - | 748613..749998 (+) | 1386 | WP_057079050.1 | phage baseplate upper protein | - |
| AKO66_RS03750 (AKO66_03745) | - | 750016..750315 (+) | 300 | WP_057079051.1 | hypothetical protein | - |
| AKO66_RS03755 (AKO66_03750) | - | 750312..750491 (+) | 180 | WP_017358175.1 | XkdX family protein | - |
| AKO66_RS03760 (AKO66_03755) | - | 750534..750956 (+) | 423 | WP_057079052.1 | holin family protein | - |
| AKO66_RS03765 (AKO66_03760) | - | 751002..751811 (+) | 810 | WP_057079053.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AKO66_RS19940 | - | 752019..752189 (+) | 171 | WP_157834353.1 | hypothetical protein | - |
| AKO66_RS03770 (AKO66_03765) | - | 752831..753019 (-) | 189 | WP_057079054.1 | hypothetical protein | - |
| AKO66_RS03775 (AKO66_03770) | - | 753088..754020 (-) | 933 | WP_057079055.1 | hypothetical protein | - |
| AKO66_RS20320 (AKO66_03775) | - | 754170..754331 (+) | 162 | Protein_742 | recombinase family protein | - |
| AKO66_RS03785 (AKO66_03780) | - | 754726..755190 (+) | 465 | WP_008347791.1 | DinB family protein | - |
Sequence
Protein
Download Length: 198 a.a. Molecular weight: 21846.03 Da Isoelectric Point: 4.6905
>NTDB_id=153484 AKO66_RS03535 WP_007500118.1 714073..714669(-) (clpP) [Bacillus altitudinis strain NJ-V]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ
PIEVIERDTDRDNFKTAEEALQYGLIDKVLTRNTEEQK
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ
PIEVIERDTDRDNFKTAEEALQYGLIDKVLTRNTEEQK
Nucleotide
Download Length: 597 bp
>NTDB_id=153484 AKO66_RS03535 WP_007500118.1 714073..714669(-) (clpP) [Bacillus altitudinis strain NJ-V]
ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA
CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTATCACAGCTTCTCTTCTTAGAAGCCG
AGGATCCAGAAAAAGATATCTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTATGACACG
ATGCAATTTATTAAACCAAAGGTATCAACTATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG
TGAAAAAGGTAAGCGTTATGCCCTTCCAAATAGTGAAGTGATGATTCACCAACCACTAGGTGGTGCGCAAGGTCAAGCAA
CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG
CCAATTGAAGTCATTGAGCGCGATACAGATCGTGACAACTTTAAAACAGCGGAAGAAGCACTTCAATACGGACTCATTGA
CAAAGTCTTGACCCGTAATACAGAAGAACAAAAATAA
ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA
CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTATCACAGCTTCTCTTCTTAGAAGCCG
AGGATCCAGAAAAAGATATCTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTATGACACG
ATGCAATTTATTAAACCAAAGGTATCAACTATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG
TGAAAAAGGTAAGCGTTATGCCCTTCCAAATAGTGAAGTGATGATTCACCAACCACTAGGTGGTGCGCAAGGTCAAGCAA
CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG
CCAATTGAAGTCATTGAGCGCGATACAGATCGTGACAACTTTAAAACAGCGGAAGAAGCACTTCAATACGGACTCATTGA
CAAAGTCTTGACCCGTAATACAGAAGAACAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
93.434 |
100 |
0.934 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.539 |
96.465 |
0.652 |
| clpP | Streptococcus thermophilus LMG 18311 |
58.549 |
97.475 |
0.571 |
| clpP | Streptococcus thermophilus LMD-9 |
58.549 |
97.475 |
0.571 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
56.186 |
97.98 |
0.551 |
| clpP | Streptococcus pneumoniae Rx1 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pneumoniae D39 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pneumoniae R6 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pneumoniae TIGR4 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pyogenes JRS4 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus pyogenes MGAS315 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus mutans UA159 |
54.639 |
97.98 |
0.535 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
54.124 |
97.98 |
0.53 |