Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | AKO65_RS07210 | Genome accession | NZ_CP012329 |
| Coordinates | 1470860..1471456 (-) | Length | 198 a.a. |
| NCBI ID | WP_007500118.1 | Uniprot ID | - |
| Organism | Bacillus altitudinis strain NJ-M2 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1470860..1511977 | 1470860..1471456 | within | 0 |
Gene organization within MGE regions
Location: 1470860..1511977
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AKO65_RS07210 (AKO65_07210) | clpP | 1470860..1471456 (-) | 597 | WP_007500118.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| AKO65_RS07220 (AKO65_07220) | - | 1471944..1473053 (-) | 1110 | WP_057079015.1 | tyrosine-type recombinase/integrase | - |
| AKO65_RS07225 (AKO65_07225) | - | 1473277..1474365 (+) | 1089 | WP_057079016.1 | AimR family lysis-lysogeny pheromone receptor | - |
| AKO65_RS07230 (AKO65_07230) | - | 1474791..1475183 (-) | 393 | WP_057079017.1 | helix-turn-helix domain-containing protein | - |
| AKO65_RS07235 (AKO65_07235) | - | 1475347..1475553 (+) | 207 | WP_057079018.1 | helix-turn-helix domain-containing protein | - |
| AKO65_RS07240 (AKO65_07240) | - | 1475590..1475916 (+) | 327 | WP_081038980.1 | DUF771 domain-containing protein | - |
| AKO65_RS07245 (AKO65_07245) | - | 1475949..1476800 (+) | 852 | WP_057079020.1 | conserved phage C-terminal domain-containing protein | - |
| AKO65_RS07250 (AKO65_07250) | - | 1476739..1477605 (+) | 867 | WP_234781024.1 | AAA family ATPase | - |
| AKO65_RS19955 | - | 1477714..1477869 (+) | 156 | WP_164071250.1 | DUF6906 family protein | - |
| AKO65_RS07255 (AKO65_07255) | - | 1477866..1478396 (+) | 531 | WP_057079022.1 | hypothetical protein | - |
| AKO65_RS19845 | - | 1478448..1478582 (+) | 135 | WP_117590493.1 | BH0509 family protein | - |
| AKO65_RS19960 | - | 1478589..1478771 (+) | 183 | WP_234781026.1 | hypothetical protein | - |
| AKO65_RS07260 (AKO65_07260) | - | 1478841..1479050 (+) | 210 | WP_057079023.1 | XtrA/YqaO family protein | - |
| AKO65_RS07265 (AKO65_07265) | - | 1479084..1479335 (+) | 252 | WP_057079024.1 | hypothetical protein | - |
| AKO65_RS07270 (AKO65_07270) | - | 1479364..1480104 (+) | 741 | WP_057079025.1 | hypothetical protein | - |
| AKO65_RS19965 | - | 1480115..1480291 (+) | 177 | WP_164071252.1 | hypothetical protein | - |
| AKO65_RS19420 | - | 1480288..1480767 (+) | 480 | WP_081038944.1 | hypothetical protein | - |
| AKO65_RS07285 (AKO65_07285) | - | 1480783..1481055 (+) | 273 | WP_057079026.1 | hypothetical protein | - |
| AKO65_RS07290 (AKO65_07290) | - | 1481052..1481462 (+) | 411 | WP_057079027.1 | hypothetical protein | - |
| AKO65_RS07295 (AKO65_07295) | - | 1481669..1482571 (+) | 903 | WP_057079028.1 | hypothetical protein | - |
| AKO65_RS20255 | - | 1482674..1482796 (+) | 123 | WP_268761895.1 | hypothetical protein | - |
| AKO65_RS07300 (AKO65_07300) | - | 1482810..1483256 (+) | 447 | WP_057079029.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AKO65_RS07305 (AKO65_07305) | - | 1483253..1483795 (+) | 543 | WP_057079030.1 | site-specific integrase | - |
| AKO65_RS07310 (AKO65_07310) | - | 1484122..1484598 (+) | 477 | WP_057079031.1 | hypothetical protein | - |
| AKO65_RS07315 (AKO65_07315) | - | 1484922..1485203 (+) | 282 | WP_057079032.1 | hypothetical protein | - |
| AKO65_RS07320 (AKO65_07320) | - | 1485398..1486612 (+) | 1215 | WP_057079033.1 | PIN-like domain-containing protein | - |
| AKO65_RS07325 (AKO65_07325) | - | 1486697..1487053 (+) | 357 | WP_057079034.1 | hypothetical protein | - |
| AKO65_RS07330 (AKO65_07330) | - | 1487043..1487408 (+) | 366 | WP_057079035.1 | HNH endonuclease | - |
| AKO65_RS07340 (AKO65_07340) | - | 1487636..1488154 (+) | 519 | WP_057079037.1 | phage terminase small subunit P27 family | - |
| AKO65_RS07345 (AKO65_07345) | - | 1488151..1489860 (+) | 1710 | WP_057079038.1 | terminase large subunit | - |
| AKO65_RS07350 (AKO65_07350) | - | 1489876..1490070 (+) | 195 | WP_025094076.1 | hypothetical protein | - |
| AKO65_RS07355 (AKO65_07355) | - | 1490067..1491368 (+) | 1302 | WP_034667988.1 | phage portal protein | - |
| AKO65_RS07360 (AKO65_07360) | - | 1491325..1492041 (+) | 717 | WP_057079039.1 | head maturation protease, ClpP-related | - |
| AKO65_RS07365 (AKO65_07365) | - | 1492146..1493345 (+) | 1200 | WP_057079794.1 | phage major capsid protein | - |
| AKO65_RS07370 (AKO65_07370) | - | 1493373..1493771 (+) | 399 | WP_057079040.1 | collagen-like protein | - |
| AKO65_RS07375 (AKO65_07375) | - | 1493784..1494092 (+) | 309 | WP_057079041.1 | head-tail connector protein | - |
| AKO65_RS07380 (AKO65_07380) | - | 1494082..1494396 (+) | 315 | WP_057079042.1 | phage head closure protein | - |
| AKO65_RS07385 (AKO65_07385) | - | 1494396..1494800 (+) | 405 | WP_025094083.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AKO65_RS07390 (AKO65_07390) | gp17 | 1494797..1495195 (+) | 399 | WP_057079043.1 | tail completion protein gp17 | - |
| AKO65_RS07395 (AKO65_07395) | - | 1495198..1495812 (+) | 615 | WP_057079044.1 | major tail protein | - |
| AKO65_RS07400 (AKO65_07400) | gpG | 1495869..1496213 (+) | 345 | WP_057079045.1 | phage tail assembly chaperone G | - |
| AKO65_RS07405 (AKO65_07405) | - | 1496426..1500871 (+) | 4446 | WP_057079046.1 | phage tail tape measure protein | - |
| AKO65_RS07410 (AKO65_07410) | - | 1500872..1501708 (+) | 837 | WP_057079047.1 | phage tail domain-containing protein | - |
| AKO65_RS07415 (AKO65_07415) | - | 1501720..1503474 (+) | 1755 | WP_057079048.1 | phage tail protein | - |
| AKO65_RS07420 (AKO65_07420) | - | 1503512..1505386 (+) | 1875 | WP_057079049.1 | right-handed parallel beta-helix repeat-containing protein | - |
| AKO65_RS07425 (AKO65_07425) | - | 1505400..1506785 (+) | 1386 | WP_057079050.1 | phage baseplate upper protein | - |
| AKO65_RS07430 (AKO65_07430) | - | 1506803..1507102 (+) | 300 | WP_057079051.1 | hypothetical protein | - |
| AKO65_RS07435 (AKO65_07435) | - | 1507099..1507278 (+) | 180 | WP_017358175.1 | XkdX family protein | - |
| AKO65_RS07440 (AKO65_07440) | - | 1507321..1507743 (+) | 423 | WP_057079052.1 | phage holin family protein | - |
| AKO65_RS07445 (AKO65_07445) | - | 1507789..1508598 (+) | 810 | WP_057079053.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AKO65_RS19970 | - | 1508806..1508976 (+) | 171 | WP_157834353.1 | hypothetical protein | - |
| AKO65_RS07450 (AKO65_07450) | - | 1509618..1509806 (-) | 189 | WP_057079054.1 | hypothetical protein | - |
| AKO65_RS07455 (AKO65_07455) | - | 1509875..1510807 (-) | 933 | WP_057079055.1 | hypothetical protein | - |
| AKO65_RS20320 (AKO65_07460) | - | 1510957..1511118 (+) | 162 | Protein_1458 | recombinase family protein | - |
| AKO65_RS07465 (AKO65_07465) | - | 1511513..1511977 (+) | 465 | WP_008347791.1 | DinB family protein | - |
Sequence
Protein
Download Length: 198 a.a. Molecular weight: 21846.03 Da Isoelectric Point: 4.6905
>NTDB_id=153427 AKO65_RS07210 WP_007500118.1 1470860..1471456(-) (clpP) [Bacillus altitudinis strain NJ-M2]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ
PIEVIERDTDRDNFKTAEEALQYGLIDKVLTRNTEEQK
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ
PIEVIERDTDRDNFKTAEEALQYGLIDKVLTRNTEEQK
Nucleotide
Download Length: 597 bp
>NTDB_id=153427 AKO65_RS07210 WP_007500118.1 1470860..1471456(-) (clpP) [Bacillus altitudinis strain NJ-M2]
ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA
CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTATCACAGCTTCTCTTCTTAGAAGCCG
AGGATCCAGAAAAAGATATCTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTATGACACG
ATGCAATTTATTAAACCAAAGGTATCAACTATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG
TGAAAAAGGTAAGCGTTATGCCCTTCCAAATAGTGAAGTGATGATTCACCAACCACTAGGTGGTGCGCAAGGTCAAGCAA
CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG
CCAATTGAAGTCATTGAGCGCGATACAGATCGTGACAACTTTAAAACAGCGGAAGAAGCACTTCAATACGGACTCATTGA
CAAAGTCTTGACCCGTAATACAGAAGAACAAAAATAA
ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA
CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTATCACAGCTTCTCTTCTTAGAAGCCG
AGGATCCAGAAAAAGATATCTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTATGACACG
ATGCAATTTATTAAACCAAAGGTATCAACTATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG
TGAAAAAGGTAAGCGTTATGCCCTTCCAAATAGTGAAGTGATGATTCACCAACCACTAGGTGGTGCGCAAGGTCAAGCAA
CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG
CCAATTGAAGTCATTGAGCGCGATACAGATCGTGACAACTTTAAAACAGCGGAAGAAGCACTTCAATACGGACTCATTGA
CAAAGTCTTGACCCGTAATACAGAAGAACAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
93.434 |
100 |
0.934 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.539 |
96.465 |
0.652 |
| clpP | Streptococcus thermophilus LMG 18311 |
58.549 |
97.475 |
0.571 |
| clpP | Streptococcus thermophilus LMD-9 |
58.549 |
97.475 |
0.571 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
56.186 |
97.98 |
0.551 |
| clpP | Streptococcus pneumoniae Rx1 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pneumoniae D39 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pneumoniae R6 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pneumoniae TIGR4 |
55.67 |
97.98 |
0.545 |
| clpP | Streptococcus pyogenes JRS4 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus pyogenes MGAS315 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus mutans UA159 |
54.639 |
97.98 |
0.535 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
54.124 |
97.98 |
0.53 |