Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HKU488_RS07385 | Genome accession | NZ_CP012045 |
| Coordinates | 1469707..1469886 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain HKU488 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1469707..1510323 | 1469707..1469886 | within | 0 |
Gene organization within MGE regions
Location: 1469707..1510323
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HKU488_RS07385 (HKU488_01361) | prx | 1469707..1469886 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| HKU488_RS07390 (HKU488_01362) | sda1 | 1470125..1471297 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| HKU488_RS07395 (HKU488_01363) | - | 1471413..1472609 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| HKU488_RS07405 (HKU488_01365) | - | 1472720..1472905 (-) | 186 | WP_002988802.1 | holin | - |
| HKU488_RS07410 (HKU488_01366) | - | 1472902..1473201 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| HKU488_RS07415 (HKU488_01367) | - | 1473212..1473832 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| HKU488_RS10120 (HKU488_01368) | - | 1473835..1473996 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| HKU488_RS07420 (HKU488_01369) | - | 1474005..1475912 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| HKU488_RS07425 (HKU488_01370) | - | 1475923..1476558 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| HKU488_RS07430 (HKU488_01371) | - | 1476558..1477613 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| HKU488_RS07435 (HKU488_01372) | - | 1477610..1479592 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| HKU488_RS07440 (HKU488_01373) | - | 1479602..1480444 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| HKU488_RS07445 (HKU488_01374) | - | 1480456..1484838 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| HKU488_RS07450 (HKU488_01375) | - | 1484853..1485086 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| HKU488_RS07455 (HKU488_01376) | - | 1485161..1485616 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| HKU488_RS07460 (HKU488_01377) | - | 1485670..1486269 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| HKU488_RS07465 (HKU488_01378) | - | 1486281..1486640 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| HKU488_RS07470 (HKU488_01379) | - | 1486644..1486988 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| HKU488_RS07475 (HKU488_01380) | - | 1486985..1487263 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| HKU488_RS07480 (HKU488_01381) | - | 1487274..1487630 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| HKU488_RS07485 (HKU488_01382) | - | 1487642..1488529 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| HKU488_RS07490 (HKU488_01383) | - | 1488542..1489111 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| HKU488_RS07495 (HKU488_01384) | - | 1489267..1489533 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| HKU488_RS07500 | - | 1489536..1489724 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| HKU488_RS07505 (HKU488_01386) | - | 1489755..1491200 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| HKU488_RS07510 (HKU488_01387) | - | 1491160..1492692 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| HKU488_RS07515 (HKU488_01388) | - | 1492708..1493985 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| HKU488_RS07520 (HKU488_01389) | - | 1493975..1494427 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| HKU488_RS07525 (HKU488_01390) | - | 1494517..1494933 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| HKU488_RS07530 (HKU488_01391) | - | 1494930..1495121 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| HKU488_RS07535 (HKU488_01392) | - | 1495111..1495962 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| HKU488_RS07540 (HKU488_01393) | - | 1495971..1496237 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| HKU488_RS10470 (HKU488_01394) | - | 1496234..1496401 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| HKU488_RS07545 (HKU488_01395) | - | 1496402..1497724 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| HKU488_RS07550 (HKU488_01396) | - | 1497721..1497996 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| HKU488_RS07555 (HKU488_01397) | - | 1498383..1500767 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| HKU488_RS07560 (HKU488_01398) | - | 1500772..1502694 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| HKU488_RS07565 (HKU488_01399) | - | 1502737..1503294 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| HKU488_RS07570 (HKU488_01400) | - | 1503305..1503703 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| HKU488_RS07575 (HKU488_01401) | - | 1503707..1504861 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| HKU488_RS07580 (HKU488_01402) | - | 1504861..1505160 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| HKU488_RS07585 (HKU488_01403) | - | 1505248..1505451 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| HKU488_RS10475 (HKU488_01404) | - | 1505448..1505600 (-) | 153 | WP_011285675.1 | hypothetical protein | - |
| HKU488_RS07590 (HKU488_01405) | - | 1505597..1505983 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| HKU488_RS07595 (HKU488_01406) | - | 1505980..1506183 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| HKU488_RS10125 (HKU488_01407) | - | 1506176..1506346 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| HKU488_RS07600 (HKU488_01408) | - | 1506343..1506618 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| HKU488_RS07605 (HKU488_01409) | - | 1506680..1506895 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| HKU488_RS07610 (HKU488_01410) | - | 1506943..1507356 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| HKU488_RS10480 (HKU488_01411) | - | 1507337..1507492 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| HKU488_RS07615 (HKU488_01412) | - | 1507818..1508168 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| HKU488_RS07620 (HKU488_01413) | - | 1508182..1508565 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HKU488_RS07625 (HKU488_01414) | - | 1508576..1509127 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| HKU488_RS07630 (HKU488_01415) | - | 1509244..1510323 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=150797 HKU488_RS07385 WP_002988813.1 1469707..1469886(-) (prx) [Streptococcus pyogenes strain HKU488]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=150797 HKU488_RS07385 WP_002988813.1 1469707..1469886(-) (prx) [Streptococcus pyogenes strain HKU488]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |