Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HKU488_RS06140 | Genome accession | NZ_CP012045 |
| Coordinates | 1230031..1230213 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain HKU488 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1230031..1265040 | 1230031..1230213 | within | 0 |
Gene organization within MGE regions
Location: 1230031..1265040
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HKU488_RS06140 (HKU488_01107) | prx | 1230031..1230213 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| HKU488_RS06145 (HKU488_01108) | sda3 | 1230452..1231252 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| HKU488_RS06150 (HKU488_01109) | - | 1231523..1231957 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| HKU488_RS06155 (HKU488_01110) | - | 1232027..1233232 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| HKU488_RS06165 (HKU488_01112) | - | 1233348..1233575 (-) | 228 | WP_003058873.1 | phage holin | - |
| HKU488_RS06170 (HKU488_01113) | - | 1233572..1233847 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| HKU488_RS06175 (HKU488_01114) | - | 1233857..1234474 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| HKU488_RS06180 (HKU488_01115) | - | 1234471..1234908 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| HKU488_RS06185 (HKU488_01116) | - | 1234920..1236788 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| HKU488_RS06190 (HKU488_01117) | - | 1236785..1237480 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| HKU488_RS06195 (HKU488_01118) | - | 1237477..1239834 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| HKU488_RS06200 (HKU488_01119) | - | 1239834..1240205 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| HKU488_RS06205 (HKU488_01120) | - | 1240220..1240483 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| HKU488_RS06210 (HKU488_01121) | - | 1240494..1241087 (-) | 594 | WP_010922456.1 | tail protein | - |
| HKU488_RS06215 (HKU488_01122) | - | 1241099..1241434 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| HKU488_RS06220 (HKU488_01123) | - | 1241435..1241671 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| HKU488_RS06225 (HKU488_01124) | - | 1241664..1242002 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| HKU488_RS06230 (HKU488_01125) | - | 1241962..1242384 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| HKU488_RS06235 (HKU488_01126) | - | 1242394..1242594 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| HKU488_RS06240 (HKU488_01127) | - | 1242594..1243505 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| HKU488_RS06245 (HKU488_01128) | - | 1243530..1243991 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| HKU488_RS06250 (HKU488_01129) | - | 1244072..1245487 (-) | 1416 | WP_011285619.1 | terminase | - |
| HKU488_RS06255 (HKU488_01130) | - | 1245597..1245863 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| HKU488_RS06260 (HKU488_01131) | - | 1245856..1246035 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| HKU488_RS06265 (HKU488_01132) | - | 1246085..1246309 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| HKU488_RS06270 (HKU488_01133) | - | 1246315..1247808 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| HKU488_RS06275 (HKU488_01134) | - | 1247801..1249069 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| HKU488_RS06280 (HKU488_01135) | - | 1249066..1249421 (-) | 356 | Protein_1200 | hypothetical protein | - |
| HKU488_RS06285 | - | 1249570..1249914 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| HKU488_RS06290 (HKU488_01136) | - | 1250023..1250442 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| HKU488_RS06295 (HKU488_01137) | - | 1250710..1251345 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| HKU488_RS06300 (HKU488_01138) | - | 1251347..1251616 (-) | 270 | WP_049525058.1 | hypothetical protein | - |
| HKU488_RS06305 (HKU488_01139) | - | 1251700..1252212 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| HKU488_RS06310 (HKU488_01140) | - | 1252209..1252550 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| HKU488_RS10445 (HKU488_01141) | - | 1252728..1252895 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| HKU488_RS06315 (HKU488_01142) | - | 1252905..1253702 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| HKU488_RS06320 (HKU488_01143) | - | 1253699..1254628 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| HKU488_RS06325 (HKU488_01144) | - | 1254631..1254960 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| HKU488_RS06330 (HKU488_01145) | - | 1255016..1255222 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| HKU488_RS10340 (HKU488_01146) | - | 1255231..1255371 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| HKU488_RS06335 (HKU488_01147) | - | 1255368..1255601 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| HKU488_RS06340 (HKU488_01148) | - | 1255582..1255971 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| HKU488_RS10610 (HKU488_01149) | - | 1256116..1256355 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| HKU488_RS06350 (HKU488_01150) | - | 1256455..1256640 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| HKU488_RS06355 (HKU488_01151) | - | 1256642..1256953 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| HKU488_RS06360 (HKU488_01152) | - | 1257031..1257216 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| HKU488_RS06365 (HKU488_01153) | - | 1257383..1257622 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| HKU488_RS06370 (HKU488_01154) | - | 1257764..1258570 (+) | 807 | WP_049525064.1 | TIGR02391 family protein | - |
| HKU488_RS10070 (HKU488_01155) | - | 1258505..1258771 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| HKU488_RS06375 (HKU488_01156) | - | 1258803..1259519 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| HKU488_RS06380 (HKU488_01157) | - | 1259531..1259722 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| HKU488_RS10075 | - | 1260358..1260453 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| HKU488_RS06385 (HKU488_01159) | - | 1260876..1261223 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| HKU488_RS06390 (HKU488_01160) | - | 1261227..1261607 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HKU488_RS06395 (HKU488_01161) | - | 1261619..1261885 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| HKU488_RS06400 (HKU488_01162) | - | 1262009..1263151 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| HKU488_RS06405 (HKU488_01163) | - | 1263241..1263516 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| HKU488_RS06410 (HKU488_01164) | - | 1263615..1264202 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| HKU488_RS06415 (HKU488_01165) | - | 1264180..1265022 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=150790 HKU488_RS06140 WP_011017964.1 1230031..1230213(-) (prx) [Streptococcus pyogenes strain HKU488]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=150790 HKU488_RS06140 WP_011017964.1 1230031..1230213(-) (prx) [Streptococcus pyogenes strain HKU488]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |