Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SpyM6D471_RS05330 | Genome accession | NZ_CP011415 |
| Coordinates | 1086468..1086650 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain D471 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1086468..1122794 | 1086468..1086650 | within | 0 |
Gene organization within MGE regions
Location: 1086468..1122794
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SpyM6D471_RS05330 (SpyM6D471_05325) | prx | 1086468..1086650 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| SpyM6D471_RS05335 (SpyM6D471_05330) | mf2 | 1086890..1087648 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| SpyM6D471_RS05340 (SpyM6D471_05335) | speC | 1087759..1088466 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| SpyM6D471_RS05345 (SpyM6D471_05340) | - | 1088535..1089287 (-) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| SpyM6D471_RS05355 (SpyM6D471_05350) | - | 1089405..1089860 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| SpyM6D471_RS05360 (SpyM6D471_05355) | - | 1089870..1090481 (-) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| SpyM6D471_RS05365 (SpyM6D471_05360) | - | 1090484..1090912 (-) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| SpyM6D471_RS05370 (SpyM6D471_05365) | - | 1090921..1092702 (-) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| SpyM6D471_RS05375 (SpyM6D471_05370) | - | 1092717..1093826 (-) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| SpyM6D471_RS05380 (SpyM6D471_05375) | - | 1093826..1095799 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| SpyM6D471_RS05385 (SpyM6D471_05380) | - | 1095781..1096476 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| SpyM6D471_RS05390 (SpyM6D471_05385) | - | 1096473..1098836 (-) | 2364 | WP_047149495.1 | hypothetical protein | - |
| SpyM6D471_RS05395 (SpyM6D471_05390) | - | 1098836..1099207 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| SpyM6D471_RS05400 (SpyM6D471_05395) | - | 1099222..1099485 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SpyM6D471_RS05405 (SpyM6D471_05400) | - | 1099496..1100086 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| SpyM6D471_RS05410 (SpyM6D471_05405) | - | 1100102..1100437 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| SpyM6D471_RS05415 (SpyM6D471_05410) | - | 1100438..1100674 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| SpyM6D471_RS05420 (SpyM6D471_05415) | - | 1100667..1101005 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| SpyM6D471_RS05425 (SpyM6D471_05420) | - | 1100965..1101387 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SpyM6D471_RS05430 (SpyM6D471_05425) | - | 1101397..1101597 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| SpyM6D471_RS05435 (SpyM6D471_05430) | - | 1101597..1102508 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| SpyM6D471_RS05440 (SpyM6D471_05435) | - | 1102533..1102994 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| SpyM6D471_RS05445 (SpyM6D471_05440) | - | 1103075..1104490 (-) | 1416 | WP_011054685.1 | terminase | - |
| SpyM6D471_RS05450 (SpyM6D471_05445) | - | 1104572..1104787 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| SpyM6D471_RS05455 (SpyM6D471_05450) | - | 1104789..1105055 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| SpyM6D471_RS09635 | - | 1105048..1105200 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| SpyM6D471_RS05460 (SpyM6D471_05455) | - | 1105277..1105501 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| SpyM6D471_RS05465 (SpyM6D471_05460) | - | 1105507..1107000 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SpyM6D471_RS05470 (SpyM6D471_05465) | - | 1106993..1108261 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| SpyM6D471_RS05475 (SpyM6D471_05470) | - | 1108258..1108614 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SpyM6D471_RS05480 (SpyM6D471_05475) | - | 1108762..1109106 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| SpyM6D471_RS05485 (SpyM6D471_05480) | - | 1109214..1109633 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| SpyM6D471_RS05490 (SpyM6D471_05485) | - | 1109709..1109960 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| SpyM6D471_RS09640 | - | 1109957..1110112 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| SpyM6D471_RS05495 (SpyM6D471_05490) | - | 1110109..1110426 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| SpyM6D471_RS05500 (SpyM6D471_05495) | - | 1110462..1110974 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| SpyM6D471_RS05505 (SpyM6D471_05500) | - | 1110971..1111303 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| SpyM6D471_RS05510 (SpyM6D471_05505) | - | 1111314..1112660 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| SpyM6D471_RS05515 (SpyM6D471_05510) | - | 1112657..1113052 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| SpyM6D471_RS05520 (SpyM6D471_05515) | - | 1113417..1114214 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SpyM6D471_RS05525 (SpyM6D471_05520) | - | 1114207..1114407 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| SpyM6D471_RS05530 (SpyM6D471_05525) | - | 1114404..1115330 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| SpyM6D471_RS05535 (SpyM6D471_05530) | - | 1115333..1115662 (-) | 330 | WP_010922207.1 | hypothetical protein | - |
| SpyM6D471_RS05540 (SpyM6D471_05535) | - | 1115718..1115924 (-) | 207 | WP_002990074.1 | hypothetical protein | - |
| SpyM6D471_RS09645 | - | 1115933..1116073 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| SpyM6D471_RS05545 (SpyM6D471_05540) | - | 1116070..1116303 (-) | 234 | WP_002988350.1 | hypothetical protein | - |
| SpyM6D471_RS05550 (SpyM6D471_05545) | - | 1116284..1116670 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| SpyM6D471_RS09775 (SpyM6D471_05550) | - | 1116811..1117080 (-) | 270 | WP_011106700.1 | replication protein | - |
| SpyM6D471_RS05560 (SpyM6D471_05555) | - | 1117174..1117359 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| SpyM6D471_RS05565 (SpyM6D471_05560) | - | 1117361..1117672 (-) | 312 | WP_010922478.1 | excisionase | - |
| SpyM6D471_RS05570 (SpyM6D471_05565) | - | 1117942..1118154 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SpyM6D471_RS05575 (SpyM6D471_05570) | - | 1118355..1119110 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| SpyM6D471_RS05580 (SpyM6D471_05575) | - | 1119122..1119640 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SpyM6D471_RS05585 (SpyM6D471_05580) | - | 1119764..1120906 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| SpyM6D471_RS05590 (SpyM6D471_05585) | - | 1120995..1121270 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SpyM6D471_RS05595 (SpyM6D471_05590) | - | 1121369..1121956 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| SpyM6D471_RS05600 (SpyM6D471_05595) | - | 1121934..1122776 (-) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=145811 SpyM6D471_RS05330 WP_011184726.1 1086468..1086650(-) (prx) [Streptococcus pyogenes strain D471]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=145811 SpyM6D471_RS05330 WP_011184726.1 1086468..1086650(-) (prx) [Streptococcus pyogenes strain D471]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |