Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   MGAS11027_RS00605 Genome accession   NZ_CP013838
Coordinates   98489..98773 (+) Length   94 a.a.
NCBI ID   WP_063510177.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain MGAS11027     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 93489..103773
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MGAS11027_RS00580 (MGAS11027_0121) - 95435..95800 (+) 366 WP_002986560.1 DUF1033 family protein -
  MGAS11027_RS00585 (MGAS11027_0122) comGA 95893..96831 (+) 939 WP_023612548.1 competence type IV pilus ATPase ComGA Machinery gene
  MGAS11027_RS00590 (MGAS11027_0123) comGB 96767..97801 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  MGAS11027_RS00595 (MGAS11027_0124) comGC 97803..98129 (+) 327 WP_063510176.1 competence type IV pilus major pilin ComGC Machinery gene
  MGAS11027_RS00600 (MGAS11027_0125) comGD 98104..98532 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  MGAS11027_RS00605 (MGAS11027_0126) comGE 98489..98773 (+) 285 WP_063510177.1 competence type IV pilus minor pilin ComGE Machinery gene
  MGAS11027_RS00610 (MGAS11027_0127) comGF 98766..99200 (+) 435 WP_063510178.1 competence type IV pilus minor pilin ComGF Machinery gene
  MGAS11027_RS00615 (MGAS11027_0128) comGG 99184..99510 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  MGAS11027_RS00620 (MGAS11027_0129) comGH 99608..100561 (+) 954 WP_063510179.1 class I SAM-dependent methyltransferase Machinery gene
  MGAS11027_RS00625 (MGAS11027_0130) - 100620..101816 (+) 1197 WP_063510180.1 acetate kinase -
  MGAS11027_RS00630 (MGAS11027_0131) - 102003..102311 (+) 309 WP_011284425.1 hypothetical protein -
  MGAS11027_RS00635 (MGAS11027_0132) proC 102394..103164 (-) 771 WP_011284426.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10684.62 Da        Isoelectric Point: 8.9043

>NTDB_id=142732 MGAS11027_RS00605 WP_063510177.1 98489..98773(+) (comGE) [Streptococcus pyogenes strain MGAS11027]
MGIIKKQVKAYIALESIIATGILFSIVILVLSSLQQSQATLTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=142732 MGAS11027_RS00605 WP_063510177.1 98489..98773(+) (comGE) [Streptococcus pyogenes strain MGAS11027]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATAATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTACTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment