Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | AU077_RS11135 | Genome accession | NZ_CP013688 |
| Coordinates | 138137..138277 (-) | Length | 46 a.a. |
| NCBI ID | WP_014295304.1 | Uniprot ID | A0A1C3SR64 |
| Organism | Streptococcus gallolyticus strain ICDDRB-NRC-S1 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 133137..143277
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AU077_RS00675 (AU077_00675) | - | 133642..133842 (+) | 201 | WP_058621369.1 | hypothetical protein | - |
| AU077_RS00690 (AU077_00690) | - | 135730..136056 (+) | 327 | WP_058621371.1 | LytTR family DNA-binding domain-containing protein | - |
| AU077_RS00695 (AU077_00695) | comE/comE1 | 136073..136804 (+) | 732 | WP_058621372.1 | response regulator transcription factor | Regulator |
| AU077_RS00700 (AU077_00700) | comD/comD1 | 136809..138119 (+) | 1311 | WP_058621373.1 | sensor histidine kinase | Regulator |
| AU077_RS11135 | comC/comC1 | 138137..138277 (-) | 141 | WP_014295304.1 | hypothetical protein | Regulator |
| AU077_RS00705 (AU077_00705) | - | 138578..138877 (+) | 300 | WP_058621374.1 | DUF3884 family protein | - |
| AU077_RS00710 (AU077_00710) | - | 138887..139036 (+) | 150 | WP_039671232.1 | hypothetical protein | - |
| AU077_RS00715 (AU077_00715) | - | 139048..139359 (+) | 312 | WP_039671231.1 | bacteriocin immunity protein | - |
| AU077_RS11140 (AU077_00720) | - | 139631..139801 (+) | 171 | WP_058621375.1 | hypothetical protein | - |
| AU077_RS00725 (AU077_00725) | comD/comD3 | 139933..140247 (+) | 315 | WP_058621376.1 | GHKL domain-containing protein | Regulator |
| AU077_RS00730 (AU077_00730) | - | 140377..140634 (+) | 258 | WP_014295297.1 | hypothetical protein | - |
| AU077_RS00745 (AU077_00745) | rsgA | 141076..141948 (+) | 873 | WP_014295296.1 | ribosome small subunit-dependent GTPase A | - |
| AU077_RS00750 (AU077_00750) | rpe | 141955..142614 (+) | 660 | WP_058621377.1 | ribulose-phosphate 3-epimerase | - |
| AU077_RS00755 (AU077_00755) | - | 142611..143240 (+) | 630 | WP_058621378.1 | thiamine diphosphokinase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5471.41 Da Isoelectric Point: 10.2565
>NTDB_id=142001 AU077_RS11135 WP_014295304.1 138137..138277(-) (comC/comC1) [Streptococcus gallolyticus strain ICDDRB-NRC-S1]
MMTEKMFKELNQSELEKTIGGKNKDFLIVGPFDWFKKHQGKSQKHM
MMTEKMFKELNQSELEKTIGGKNKDFLIVGPFDWFKKHQGKSQKHM
Nucleotide
Download Length: 141 bp
>NTDB_id=142001 AU077_RS11135 WP_014295304.1 138137..138277(-) (comC/comC1) [Streptococcus gallolyticus strain ICDDRB-NRC-S1]
ATGATGACAGAAAAAATGTTTAAAGAATTAAATCAATCTGAATTAGAGAAAACGATTGGTGGAAAGAATAAGGATTTCCT
AATTGTTGGACCTTTCGATTGGTTTAAAAAACATCAAGGGAAATCACAAAAACACATGTAA
ATGATGACAGAAAAAATGTTTAAAGAATTAAATCAATCTGAATTAGAGAAAACGATTGGTGGAAAGAATAAGGATTTCCT
AATTGTTGGACCTTTCGATTGGTTTAAAAAACATCAAGGGAAATCACAAAAACACATGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus equinus JB1 |
56.667 |
65.217 |
0.37 |