Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MNA02_RS10950 | Genome accession | NZ_CP010999 |
| Coordinates | 736595..736756 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain MN-BM-A02 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 715828..744452 | 736595..736756 | within | 0 |
Gene organization within MGE regions
Location: 715828..744452
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNA02_RS03815 (MNA02_753) | - | 715828..716424 (+) | 597 | WP_011225787.1 | thymidine kinase | - |
| MNA02_RS03820 (MNA02_754) | prfA | 716461..717540 (+) | 1080 | WP_002948472.1 | peptide chain release factor 1 | - |
| MNA02_RS03825 (MNA02_755) | prmC | 717537..718370 (+) | 834 | WP_011681016.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| MNA02_RS03830 (MNA02_756) | - | 718357..718962 (+) | 606 | WP_002948474.1 | L-threonylcarbamoyladenylate synthase | - |
| MNA02_RS03835 (MNA02_757) | glyA | 719057..720307 (+) | 1251 | WP_011227085.1 | serine hydroxymethyltransferase | - |
| MNA02_RS03840 (MNA02_758) | - | 720314..721291 (+) | 978 | WP_014608183.1 | nucleoid-associated protein | - |
| MNA02_RS03845 | - | 721293..721904 (+) | 612 | WP_014621429.1 | lysozyme family protein | - |
| MNA02_RS03850 (MNA02_760) | - | 721937..723676 (+) | 1740 | WP_011681019.1 | ABC transporter ATP-binding protein | - |
| MNA02_RS03855 (MNA02_761) | - | 723666..725414 (+) | 1749 | WP_011681020.1 | ABC transporter ATP-binding protein | - |
| MNA02_RS03860 | - | 725591..725722 (+) | 132 | WP_002885174.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| MNA02_RS03865 (MNA02_763) | dltA | 725731..727281 (+) | 1551 | WP_011681022.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| MNA02_RS03870 (MNA02_764) | dltB | 727278..728525 (+) | 1248 | WP_014608186.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| MNA02_RS03875 (MNA02_765) | dltC | 728543..728782 (+) | 240 | WP_002950439.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| MNA02_RS03880 (MNA02_766) | dltD | 728775..730043 (+) | 1269 | WP_011681024.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| MNA02_RS10720 | - | 730096..731445 (-) | 1350 | Protein_718 | IS3 family transposase | - |
| MNA02_RS03910 (MNA02_772) | - | 731644..734280 (-) | 2637 | WP_014621434.1 | calcium-translocating P-type ATPase, PMCA-type | - |
| MNA02_RS03915 (MNA02_773) | pabB | 734457..736175 (-) | 1719 | WP_014608193.1 | aminodeoxychorismate synthase component I | - |
| MNA02_RS10950 (MNA02_774) | prx | 736595..736756 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| MNA02_RS03925 (MNA02_775) | - | 737240..737515 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| MNA02_RS03930 (MNA02_776) | - | 737532..737717 (-) | 186 | WP_024704073.1 | hypothetical protein | - |
| MNA02_RS03935 (MNA02_777) | - | 738015..739520 (-) | 1506 | WP_024704074.1 | phage/plasmid primase, P4 family | - |
| MNA02_RS03940 (MNA02_778) | - | 739510..740370 (-) | 861 | WP_024704075.1 | primase alpha helix C-terminal domain-containing protein | - |
| MNA02_RS03945 (MNA02_779) | - | 740385..740657 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| MNA02_RS03955 (MNA02_780) | - | 740900..741136 (-) | 237 | WP_024704076.1 | hypothetical protein | - |
| MNA02_RS03960 | - | 741150..741344 (-) | 195 | WP_024704077.1 | hypothetical protein | - |
| MNA02_RS03965 | - | 741348..741641 (-) | 294 | WP_024704078.1 | hypothetical protein | - |
| MNA02_RS03970 (MNA02_782) | - | 741880..742077 (-) | 198 | WP_014608200.1 | helix-turn-helix domain-containing protein | - |
| MNA02_RS10095 (MNA02_783) | - | 742291..742752 (+) | 462 | WP_405183738.1 | helix-turn-helix transcriptional regulator | - |
| MNA02_RS03980 (MNA02_784) | - | 742835..744001 (+) | 1167 | WP_011227104.1 | tyrosine-type recombinase/integrase | - |
| MNA02_RS03985 (MNA02_785) | - | 744117..744452 (+) | 336 | WP_002948199.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=141253 MNA02_RS10950 WP_014727422.1 736595..736756(-) (prx) [Streptococcus thermophilus strain MN-BM-A02]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=141253 MNA02_RS10950 WP_014727422.1 736595..736756(-) (prx) [Streptococcus thermophilus strain MN-BM-A02]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |