Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PhaeoP63_RS11125 | Genome accession | NZ_CP010784 |
| Coordinates | 2292731..2293201 (-) | Length | 156 a.a. |
| NCBI ID | WP_024097670.1 | Uniprot ID | - |
| Organism | Phaeobacter gallaeciensis strain P63 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2263719..2305205 | 2292731..2293201 | within | 0 |
Gene organization within MGE regions
Location: 2263719..2305205
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PhaeoP63_RS10930 (PhaeoP63_02217) | - | 2263719..2264699 (-) | 981 | WP_024097627.1 | glycosyltransferase family 2 protein | - |
| PhaeoP63_RS10935 (PhaeoP63_02218) | - | 2264889..2266091 (+) | 1203 | WP_024097628.1 | tyrosine-type recombinase/integrase | - |
| PhaeoP63_RS10940 (PhaeoP63_02220) | - | 2266337..2266564 (-) | 228 | WP_024097630.1 | hypothetical protein | - |
| PhaeoP63_RS10945 (PhaeoP63_02221) | - | 2266698..2267417 (+) | 720 | WP_081731446.1 | DNA cytosine methyltransferase | - |
| PhaeoP63_RS10950 (PhaeoP63_02222) | - | 2267451..2268086 (+) | 636 | WP_024097632.1 | hypothetical protein | - |
| PhaeoP63_RS10955 (PhaeoP63_02223) | - | 2268125..2268334 (+) | 210 | WP_024097633.1 | hypothetical protein | - |
| PhaeoP63_RS10960 (PhaeoP63_02224) | - | 2268348..2268581 (+) | 234 | WP_024097634.1 | hypothetical protein | - |
| PhaeoP63_RS10970 (PhaeoP63_02226) | - | 2268696..2268980 (+) | 285 | WP_024097635.1 | hypothetical protein | - |
| PhaeoP63_RS22840 | - | 2269142..2269273 (+) | 132 | WP_275541792.1 | hypothetical protein | - |
| PhaeoP63_RS10975 (PhaeoP63_02228) | - | 2269451..2269690 (-) | 240 | WP_024097637.1 | hypothetical protein | - |
| PhaeoP63_RS10980 (PhaeoP63_02229) | - | 2269687..2269875 (-) | 189 | WP_024097638.1 | hypothetical protein | - |
| PhaeoP63_RS10985 (PhaeoP63_02230) | - | 2269872..2270390 (-) | 519 | WP_024097639.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PhaeoP63_RS10990 (PhaeoP63_02231) | - | 2270450..2270866 (-) | 417 | WP_024097640.1 | hypothetical protein | - |
| PhaeoP63_RS22490 (PhaeoP63_02232) | - | 2270859..2271029 (-) | 171 | WP_024097641.1 | hypothetical protein | - |
| PhaeoP63_RS10995 (PhaeoP63_02233) | - | 2271026..2271229 (-) | 204 | WP_024097642.1 | hypothetical protein | - |
| PhaeoP63_RS11000 (PhaeoP63_02235) | - | 2271639..2274227 (-) | 2589 | WP_096705124.1 | hypothetical protein | - |
| PhaeoP63_RS11005 (PhaeoP63_02236) | - | 2274238..2275074 (-) | 837 | WP_024097646.1 | hypothetical protein | - |
| PhaeoP63_RS11010 (PhaeoP63_02237) | - | 2275161..2275523 (-) | 363 | WP_024097647.1 | hypothetical protein | - |
| PhaeoP63_RS11015 (PhaeoP63_02238) | - | 2275520..2276038 (-) | 519 | WP_024097648.1 | hypothetical protein | - |
| PhaeoP63_RS11020 (PhaeoP63_02239) | - | 2276035..2276808 (-) | 774 | WP_024097649.1 | KilA-N domain-containing protein | - |
| PhaeoP63_RS22930 | - | 2276838..2277056 (-) | 219 | WP_040104063.1 | Arc family DNA-binding protein | - |
| PhaeoP63_RS11030 (PhaeoP63_02240) | - | 2277160..2277453 (+) | 294 | WP_024097650.1 | Arc family DNA-binding protein | - |
| PhaeoP63_RS11035 (PhaeoP63_02241) | - | 2277486..2277668 (+) | 183 | WP_024097651.1 | hypothetical protein | - |
| PhaeoP63_RS11040 | - | 2277669..2277851 (+) | 183 | WP_040104064.1 | hypothetical protein | - |
| PhaeoP63_RS11045 (PhaeoP63_02242) | - | 2277823..2279343 (-) | 1521 | WP_024097652.1 | hypothetical protein | - |
| PhaeoP63_RS11050 (PhaeoP63_02243) | - | 2279346..2280605 (-) | 1260 | WP_024097653.1 | hypothetical protein | - |
| PhaeoP63_RS11055 (PhaeoP63_02244) | - | 2280615..2281208 (-) | 594 | WP_024097654.1 | phage tail tip lysozyme | - |
| PhaeoP63_RS11060 (PhaeoP63_02245) | - | 2281212..2282096 (-) | 885 | WP_024097655.1 | hypothetical protein | - |
| PhaeoP63_RS11065 (PhaeoP63_02246) | - | 2282096..2282524 (-) | 429 | WP_024097656.1 | hypothetical protein | - |
| PhaeoP63_RS22495 (PhaeoP63_02247) | - | 2282521..2282673 (-) | 153 | WP_024097657.1 | hypothetical protein | - |
| PhaeoP63_RS11070 (PhaeoP63_02248) | - | 2282670..2284106 (-) | 1437 | WP_024097658.1 | hypothetical protein | - |
| PhaeoP63_RS11075 (PhaeoP63_02249) | - | 2284111..2284509 (-) | 399 | WP_145957931.1 | hypothetical protein | - |
| PhaeoP63_RS22500 (PhaeoP63_02250) | - | 2284506..2284649 (-) | 144 | WP_024097660.1 | hypothetical protein | - |
| PhaeoP63_RS11085 (PhaeoP63_02251) | - | 2284706..2285947 (-) | 1242 | WP_024097661.1 | P22 phage major capsid protein family protein | - |
| PhaeoP63_RS11090 (PhaeoP63_02252) | - | 2285960..2286802 (-) | 843 | WP_024097662.1 | hypothetical protein | - |
| PhaeoP63_RS11095 (PhaeoP63_02253) | - | 2286816..2288807 (-) | 1992 | WP_024097663.1 | portal protein | - |
| PhaeoP63_RS11100 (PhaeoP63_02254) | - | 2288804..2290141 (-) | 1338 | WP_024097664.1 | phage terminase large subunit | - |
| PhaeoP63_RS11105 (PhaeoP63_02255) | - | 2290122..2290424 (-) | 303 | WP_024097665.1 | hypothetical protein | - |
| PhaeoP63_RS11110 (PhaeoP63_02256) | nusG | 2291052..2291642 (-) | 591 | WP_024097666.1 | transcription termination/antitermination protein NusG | - |
| PhaeoP63_RS11115 (PhaeoP63_02258) | - | 2291911..2292297 (-) | 387 | WP_040104067.1 | hypothetical protein | - |
| PhaeoP63_RS11120 (PhaeoP63_02259) | - | 2292309..2292731 (-) | 423 | WP_040104068.1 | HNH endonuclease signature motif containing protein | - |
| PhaeoP63_RS11125 (PhaeoP63_02260) | ssb | 2292731..2293201 (-) | 471 | WP_024097670.1 | single-stranded DNA-binding protein | Machinery gene |
| PhaeoP63_RS11130 (PhaeoP63_02261) | - | 2293201..2293569 (-) | 369 | WP_024097671.1 | helix-turn-helix domain-containing protein | - |
| PhaeoP63_RS11135 (PhaeoP63_02262) | - | 2293566..2293934 (-) | 369 | WP_024097672.1 | hypothetical protein | - |
| PhaeoP63_RS11140 (PhaeoP63_02263) | - | 2293921..2294718 (-) | 798 | WP_024097673.1 | hypothetical protein | - |
| PhaeoP63_RS11145 (PhaeoP63_02264) | - | 2294715..2295248 (-) | 534 | WP_024097674.1 | GIY-YIG nuclease family protein | - |
| PhaeoP63_RS11150 (PhaeoP63_02265) | - | 2295245..2295553 (-) | 309 | WP_024097675.1 | VRR-NUC domain protein | - |
| PhaeoP63_RS11155 (PhaeoP63_02266) | - | 2295553..2295855 (-) | 303 | WP_024097676.1 | hypothetical protein | - |
| PhaeoP63_RS11160 (PhaeoP63_02267) | - | 2295898..2296080 (-) | 183 | WP_024097677.1 | hypothetical protein | - |
| PhaeoP63_RS11165 (PhaeoP63_02269) | - | 2296199..2296522 (-) | 324 | WP_145957930.1 | hypothetical protein | - |
| PhaeoP63_RS11170 | - | 2296556..2296771 (-) | 216 | WP_102892808.1 | hypothetical protein | - |
| PhaeoP63_RS11175 (PhaeoP63_02271) | - | 2296849..2297484 (+) | 636 | WP_024097681.1 | XRE family transcriptional regulator | - |
| PhaeoP63_RS11180 (PhaeoP63_02272) | - | 2297481..2297741 (+) | 261 | WP_024097682.1 | hypothetical protein | - |
| PhaeoP63_RS11185 (PhaeoP63_02273) | - | 2297734..2298018 (+) | 285 | WP_024097683.1 | hypothetical protein | - |
| PhaeoP63_RS11190 (PhaeoP63_02274) | - | 2298224..2298568 (+) | 345 | WP_024097684.1 | hypothetical protein | - |
| PhaeoP63_RS11195 (PhaeoP63_02275) | - | 2298574..2298870 (+) | 297 | WP_024097685.1 | hypothetical protein | - |
| PhaeoP63_RS11200 (PhaeoP63_02276) | - | 2298867..2299196 (+) | 330 | WP_024097686.1 | hypothetical protein | - |
| PhaeoP63_RS11205 (PhaeoP63_02277) | - | 2299293..2299961 (+) | 669 | WP_024097687.1 | ERF family protein | - |
| PhaeoP63_RS11210 (PhaeoP63_02278) | - | 2299951..2300655 (+) | 705 | WP_024097688.1 | 3'-5' exonuclease | - |
| PhaeoP63_RS11215 (PhaeoP63_02279) | - | 2300655..2300843 (+) | 189 | WP_024097689.1 | hypothetical protein | - |
| PhaeoP63_RS11220 (PhaeoP63_02280) | - | 2300843..2301133 (+) | 291 | WP_024097690.1 | hypothetical protein | - |
| PhaeoP63_RS11225 (PhaeoP63_02281) | - | 2301147..2301602 (+) | 456 | WP_024097691.1 | hypothetical protein | - |
| PhaeoP63_RS11230 (PhaeoP63_02282) | - | 2301599..2301976 (+) | 378 | WP_024097692.1 | DUF1364 domain-containing protein | - |
| PhaeoP63_RS22505 (PhaeoP63_02283) | - | 2301998..2302579 (+) | 582 | WP_024097693.1 | hypothetical protein | - |
| PhaeoP63_RS11240 (PhaeoP63_02284) | - | 2302572..2302889 (+) | 318 | WP_024097694.1 | hypothetical protein | - |
| PhaeoP63_RS22935 (PhaeoP63_02285) | - | 2302889..2303128 (+) | 240 | WP_024097695.1 | DUF551 domain-containing protein | - |
| PhaeoP63_RS11250 (PhaeoP63_02286) | - | 2303125..2303589 (+) | 465 | WP_024097696.1 | hypothetical protein | - |
| PhaeoP63_RS11260 (PhaeoP63_02288) | - | 2303804..2304106 (+) | 303 | WP_024097698.1 | hypothetical protein | - |
| PhaeoP63_RS11265 (PhaeoP63_02289) | - | 2304103..2304312 (+) | 210 | WP_024097699.1 | hypothetical protein | - |
| PhaeoP63_RS11275 (PhaeoP63_02291) | - | 2304573..2305205 (-) | 633 | WP_024097700.1 | tetratricopeptide repeat protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 16734.28 Da Isoelectric Point: 5.7697
>NTDB_id=139817 PhaeoP63_RS11125 WP_024097670.1 2292731..2293201(-) (ssb) [Phaeobacter gallaeciensis strain P63]
MAGSLNKVQLIGNLGRDPEVRSFQNGGKVCNLRLATSETWKDRNTGERREKTEWHSVSIFSEGLVRVAEQYLRKGSKVYI
EGQLQTRKWQDQSGQDRYSTEVVLQGIGGTLTMLDSAQGGSSSGGGGDSGGCGDQGSGYGSQGGSSHNIDDTEIPF
MAGSLNKVQLIGNLGRDPEVRSFQNGGKVCNLRLATSETWKDRNTGERREKTEWHSVSIFSEGLVRVAEQYLRKGSKVYI
EGQLQTRKWQDQSGQDRYSTEVVLQGIGGTLTMLDSAQGGSSSGGGGDSGGCGDQGSGYGSQGGSSHNIDDTEIPF
Nucleotide
Download Length: 471 bp
>NTDB_id=139817 PhaeoP63_RS11125 WP_024097670.1 2292731..2293201(-) (ssb) [Phaeobacter gallaeciensis strain P63]
ATGGCAGGCAGTTTGAACAAGGTCCAGTTGATCGGAAATTTGGGCCGTGACCCCGAAGTCCGCAGCTTCCAGAACGGCGG
CAAGGTCTGCAACCTGCGTTTGGCAACTTCTGAGACGTGGAAAGACCGCAACACGGGCGAACGCCGCGAAAAGACGGAGT
GGCATTCTGTCTCGATCTTCTCCGAGGGCTTGGTTCGCGTGGCAGAGCAATACCTTCGCAAAGGCTCCAAGGTCTACATC
GAAGGCCAGTTGCAGACCCGAAAATGGCAGGACCAGAGCGGCCAGGACCGGTACTCAACTGAGGTCGTATTGCAGGGCAT
CGGCGGGACGCTGACCATGCTGGACAGCGCTCAGGGCGGCAGTAGCTCCGGCGGTGGCGGGGATAGCGGCGGCTGCGGGG
ATCAGGGGTCCGGCTACGGGAGCCAGGGCGGGTCTTCGCACAACATTGATGATACGGAGATACCTTTCTAA
ATGGCAGGCAGTTTGAACAAGGTCCAGTTGATCGGAAATTTGGGCCGTGACCCCGAAGTCCGCAGCTTCCAGAACGGCGG
CAAGGTCTGCAACCTGCGTTTGGCAACTTCTGAGACGTGGAAAGACCGCAACACGGGCGAACGCCGCGAAAAGACGGAGT
GGCATTCTGTCTCGATCTTCTCCGAGGGCTTGGTTCGCGTGGCAGAGCAATACCTTCGCAAAGGCTCCAAGGTCTACATC
GAAGGCCAGTTGCAGACCCGAAAATGGCAGGACCAGAGCGGCCAGGACCGGTACTCAACTGAGGTCGTATTGCAGGGCAT
CGGCGGGACGCTGACCATGCTGGACAGCGCTCAGGGCGGCAGTAGCTCCGGCGGTGGCGGGGATAGCGGCGGCTGCGGGG
ATCAGGGGTCCGGCTACGGGAGCCAGGGCGGGTCTTCGCACAACATTGATGATACGGAGATACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
64.516 |
79.487 |
0.513 |
| ssb | Glaesserella parasuis strain SC1401 |
53.378 |
94.872 |
0.506 |
| ssb | Neisseria gonorrhoeae MS11 |
45.985 |
87.821 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
45.985 |
87.821 |
0.404 |