Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SD90_RS06585 | Genome accession | NZ_CP010450 |
| Coordinates | 1326679..1326858 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain NGAS638 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1326679..1367295 | 1326679..1326858 | within | 0 |
Gene organization within MGE regions
Location: 1326679..1367295
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SD90_RS06585 (SD90_06595) | prx | 1326679..1326858 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| SD90_RS06590 (SD90_06600) | sda1 | 1327097..1328269 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| SD90_RS06595 (SD90_06605) | - | 1328385..1329581 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| SD90_RS06600 (SD90_06615) | - | 1329692..1329877 (-) | 186 | WP_002988802.1 | holin | - |
| SD90_RS06605 (SD90_06620) | - | 1329874..1330173 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| SD90_RS06610 (SD90_06625) | - | 1330184..1330804 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| SD90_RS09105 | - | 1330807..1330968 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| SD90_RS06615 (SD90_06630) | - | 1330977..1332884 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| SD90_RS06620 (SD90_06635) | - | 1332895..1333530 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| SD90_RS06625 (SD90_06640) | - | 1333530..1334585 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| SD90_RS06630 (SD90_06645) | - | 1334582..1336564 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| SD90_RS06635 (SD90_06650) | - | 1336574..1337416 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| SD90_RS06640 (SD90_06655) | - | 1337428..1341810 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| SD90_RS06645 (SD90_06660) | - | 1341825..1342058 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| SD90_RS06650 (SD90_06665) | - | 1342133..1342588 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| SD90_RS06655 (SD90_06670) | - | 1342642..1343241 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| SD90_RS06660 (SD90_06675) | - | 1343253..1343612 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| SD90_RS06665 (SD90_06680) | - | 1343616..1343960 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SD90_RS06670 (SD90_06685) | - | 1343957..1344235 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| SD90_RS06675 (SD90_06690) | - | 1344246..1344602 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| SD90_RS06680 (SD90_06695) | - | 1344614..1345501 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| SD90_RS06685 (SD90_06700) | - | 1345514..1346083 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| SD90_RS06690 (SD90_06705) | - | 1346239..1346505 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| SD90_RS06695 (SD90_06710) | - | 1346508..1346696 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| SD90_RS06700 (SD90_06715) | - | 1346727..1348172 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| SD90_RS06705 (SD90_06720) | - | 1348132..1349664 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| SD90_RS06710 (SD90_06725) | - | 1349680..1350957 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| SD90_RS06715 (SD90_06730) | - | 1350947..1351399 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| SD90_RS06720 (SD90_06735) | - | 1351489..1351905 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| SD90_RS06725 (SD90_06740) | - | 1351902..1352093 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| SD90_RS06730 (SD90_06745) | - | 1352083..1352934 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| SD90_RS06735 (SD90_06750) | - | 1352943..1353209 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| SD90_RS09370 | - | 1353206..1353373 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| SD90_RS06740 (SD90_06755) | - | 1353374..1354696 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| SD90_RS06745 (SD90_06760) | - | 1354693..1354968 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| SD90_RS06750 (SD90_06765) | - | 1355355..1357739 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| SD90_RS06755 (SD90_06770) | - | 1357744..1359666 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| SD90_RS06760 (SD90_06775) | - | 1359709..1360266 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| SD90_RS06765 (SD90_06780) | - | 1360277..1360675 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| SD90_RS06770 (SD90_06785) | - | 1360679..1361833 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| SD90_RS06775 (SD90_06790) | - | 1361833..1362132 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| SD90_RS06780 (SD90_06795) | - | 1362220..1362423 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| SD90_RS06785 (SD90_06800) | - | 1362569..1362955 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| SD90_RS06790 (SD90_06805) | - | 1362952..1363155 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| SD90_RS09110 | - | 1363148..1363318 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| SD90_RS06795 (SD90_06810) | - | 1363315..1363590 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| SD90_RS06800 (SD90_06815) | - | 1363652..1363867 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| SD90_RS06805 (SD90_06820) | - | 1363915..1364328 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| SD90_RS09375 | - | 1364309..1364464 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| SD90_RS06810 (SD90_06825) | - | 1364790..1365140 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| SD90_RS06815 (SD90_06830) | - | 1365154..1365537 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SD90_RS06820 (SD90_06835) | - | 1365548..1366099 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| SD90_RS06825 (SD90_06840) | - | 1366216..1367295 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=137404 SD90_RS06585 WP_002988813.1 1326679..1326858(-) (prx) [Streptococcus pyogenes strain NGAS638]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=137404 SD90_RS06585 WP_002988813.1 1326679..1326858(-) (prx) [Streptococcus pyogenes strain NGAS638]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |