Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SD89_RS06195 | Genome accession | NZ_CP010449 |
| Coordinates | 1263411..1263593 (-) | Length | 60 a.a. |
| NCBI ID | WP_053308468.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NGAS322 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1263411..1298561 | 1263411..1263593 | within | 0 |
Gene organization within MGE regions
Location: 1263411..1298561
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SD89_RS06195 (SD89_06210) | prx | 1263411..1263593 (-) | 183 | WP_053308468.1 | Paratox | Regulator |
| SD89_RS06200 (SD89_06215) | spel | 1263708..1264496 (-) | 789 | WP_053308469.1 | streptococcal pyrogenic exotoxin SpeL | - |
| SD89_RS06205 (SD89_06220) | spem | 1264778..1265491 (-) | 714 | WP_011017838.1 | streptococcal pyrogenic exotoxin SpeM | - |
| SD89_RS06210 (SD89_06225) | - | 1266357..1266998 (-) | 642 | Protein_1187 | CHAP domain-containing protein | - |
| SD89_RS06215 (SD89_06230) | - | 1267111..1267803 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| SD89_RS06220 (SD89_06235) | - | 1268039..1268593 (-) | 555 | Protein_1189 | glycoside hydrolase family 73 protein | - |
| SD89_RS06225 (SD89_06245) | - | 1268704..1268889 (-) | 186 | WP_011184796.1 | holin | - |
| SD89_RS06230 (SD89_06250) | - | 1268886..1269182 (-) | 297 | WP_053308471.1 | hypothetical protein | - |
| SD89_RS06235 (SD89_06255) | - | 1269179..1269820 (-) | 642 | WP_053308472.1 | hypothetical protein | - |
| SD89_RS06240 (SD89_06260) | - | 1269823..1270254 (-) | 432 | WP_053308473.1 | DUF1617 family protein | - |
| SD89_RS06245 (SD89_06265) | - | 1270263..1272044 (-) | 1782 | WP_053308474.1 | gp58-like family protein | - |
| SD89_RS06250 (SD89_06270) | - | 1272059..1273168 (-) | 1110 | WP_053308475.1 | hyaluronoglucosaminidase | - |
| SD89_RS06255 (SD89_06275) | - | 1273168..1275126 (-) | 1959 | WP_053308476.1 | phage tail spike protein | - |
| SD89_RS06260 (SD89_06280) | - | 1275123..1275818 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| SD89_RS06265 (SD89_06285) | - | 1275815..1278172 (-) | 2358 | WP_053308477.1 | hypothetical protein | - |
| SD89_RS06270 (SD89_06290) | - | 1278172..1278543 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| SD89_RS06275 (SD89_06295) | - | 1278558..1278821 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SD89_RS06280 (SD89_06300) | - | 1278832..1279422 (-) | 591 | WP_053308478.1 | hypothetical protein | - |
| SD89_RS06285 (SD89_06305) | - | 1279438..1279773 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| SD89_RS06290 (SD89_06310) | - | 1279774..1280010 (-) | 237 | WP_053308479.1 | hypothetical protein | - |
| SD89_RS06295 (SD89_06315) | - | 1280003..1280341 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| SD89_RS06300 (SD89_06320) | - | 1280301..1280723 (-) | 423 | WP_053308480.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SD89_RS10550 | - | 1280744..1280872 (-) | 129 | WP_258296905.1 | hypothetical protein | - |
| SD89_RS06305 (SD89_06325) | - | 1280874..1281767 (-) | 894 | WP_053308481.1 | phage major capsid protein | - |
| SD89_RS06310 (SD89_06330) | - | 1281771..1282235 (-) | 465 | WP_053308482.1 | DUF4355 domain-containing protein | - |
| SD89_RS06315 (SD89_06335) | - | 1282316..1283731 (-) | 1416 | WP_011285619.1 | terminase | - |
| SD89_RS06320 (SD89_06340) | - | 1283813..1284049 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| SD89_RS06325 (SD89_06345) | - | 1284051..1284317 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| SD89_RS06330 (SD89_06350) | - | 1284310..1284489 (-) | 180 | WP_032461150.1 | hypothetical protein | - |
| SD89_RS06335 (SD89_06355) | - | 1284539..1284763 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| SD89_RS06340 (SD89_06360) | - | 1284769..1286262 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| SD89_RS06345 (SD89_06365) | - | 1286255..1287523 (-) | 1269 | WP_053308483.1 | phage portal protein | - |
| SD89_RS06350 (SD89_06370) | - | 1287520..1287876 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SD89_RS06355 (SD89_06375) | - | 1288025..1288369 (-) | 345 | WP_053308484.1 | HNH endonuclease signature motif containing protein | - |
| SD89_RS06360 (SD89_06380) | - | 1288477..1288896 (-) | 420 | WP_003047501.1 | DUF1492 domain-containing protein | - |
| SD89_RS06365 (SD89_06385) | - | 1288972..1289223 (-) | 252 | WP_053308485.1 | hypothetical protein | - |
| SD89_RS06370 (SD89_06390) | - | 1289220..1289438 (-) | 219 | Protein_1220 | DUF1642 domain-containing protein | - |
| SD89_RS10445 (SD89_06395) | - | 1289505..1289690 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| SD89_RS06380 (SD89_06400) | - | 1289677..1290189 (-) | 513 | WP_053308486.1 | hypothetical protein | - |
| SD89_RS06385 (SD89_06405) | - | 1290186..1290527 (-) | 342 | WP_053308487.1 | hypothetical protein | - |
| SD89_RS06390 (SD89_06410) | - | 1290881..1291678 (-) | 798 | WP_053308488.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SD89_RS06395 (SD89_06415) | - | 1291675..1292604 (-) | 930 | WP_053308489.1 | recombinase RecT | - |
| SD89_RS06400 (SD89_06420) | - | 1292607..1292936 (-) | 330 | WP_032463369.1 | hypothetical protein | - |
| SD89_RS06405 (SD89_06425) | - | 1292992..1293198 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| SD89_RS10155 | - | 1293207..1293347 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| SD89_RS06410 (SD89_06430) | - | 1293344..1293577 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| SD89_RS06415 (SD89_06435) | - | 1293558..1293944 (-) | 387 | WP_023079927.1 | DnaD domain-containing protein | - |
| SD89_RS10450 (SD89_06440) | - | 1294100..1294369 (-) | 270 | WP_053308490.1 | replication protein | - |
| SD89_RS06425 (SD89_06445) | - | 1294463..1294648 (-) | 186 | WP_023079923.1 | hypothetical protein | - |
| SD89_RS06430 (SD89_06450) | - | 1294650..1294961 (-) | 312 | WP_010922478.1 | excisionase | - |
| SD89_RS06435 (SD89_06455) | - | 1295231..1295443 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SD89_RS06440 (SD89_06460) | - | 1295645..1296400 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| SD89_RS06445 (SD89_06465) | - | 1296412..1296930 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SD89_RS06450 (SD89_06470) | - | 1297054..1298196 (+) | 1143 | WP_053308491.1 | tyrosine-type recombinase/integrase | - |
| SD89_RS06455 (SD89_06475) | - | 1298286..1298561 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7066.02 Da Isoelectric Point: 4.0338
>NTDB_id=137340 SD89_RS06195 WP_053308468.1 1263411..1263593(-) (prx) [Streptococcus pyogenes strain NGAS322]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=137340 SD89_RS06195 WP_053308468.1 1263411..1263593(-) (prx) [Streptococcus pyogenes strain NGAS322]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
88.333 |
100 |
0.883 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
70 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |