Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | HKU360_RS07125 | Genome accession | NZ_CP009612 |
| Coordinates | 1441519..1441698 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain HKU360 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1441519..1482152 | 1441519..1441698 | within | 0 |
Gene organization within MGE regions
Location: 1441519..1482152
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HKU360_RS07125 (HKU360_01467) | prx | 1441519..1441698 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| HKU360_RS07130 (HKU360_01468) | sda1 | 1441937..1443109 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| HKU360_RS07135 (HKU360_01469) | - | 1443225..1444421 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| HKU360_RS07140 (HKU360_01470) | - | 1444548..1444733 (-) | 186 | WP_002988802.1 | holin | - |
| HKU360_RS07145 (HKU360_01471) | - | 1444730..1445029 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| HKU360_RS07150 (HKU360_01472) | - | 1445040..1445660 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| HKU360_RS09965 (HKU360_01473) | - | 1445663..1445824 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| HKU360_RS07155 (HKU360_01474) | - | 1445833..1447740 (-) | 1908 | WP_038433824.1 | gp58-like family protein | - |
| HKU360_RS07160 (HKU360_01475) | - | 1447751..1448386 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| HKU360_RS07165 (HKU360_01476) | - | 1448386..1449441 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| HKU360_RS07170 (HKU360_01477) | - | 1449438..1451420 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| HKU360_RS07175 (HKU360_01478) | - | 1451430..1452272 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| HKU360_RS07180 (HKU360_01479) | - | 1452284..1456666 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| HKU360_RS07185 (HKU360_01480) | - | 1456681..1456914 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| HKU360_RS07190 (HKU360_01481) | - | 1456989..1457444 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| HKU360_RS07195 (HKU360_01482) | - | 1457498..1458097 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| HKU360_RS07200 (HKU360_01483) | - | 1458109..1458468 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| HKU360_RS07205 (HKU360_01484) | - | 1458472..1458816 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| HKU360_RS07210 (HKU360_01485) | - | 1458813..1459091 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| HKU360_RS07215 (HKU360_01486) | - | 1459102..1459458 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| HKU360_RS07220 (HKU360_01487) | - | 1459470..1460357 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| HKU360_RS07225 (HKU360_01488) | - | 1460370..1460939 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| HKU360_RS07230 (HKU360_01489) | - | 1461095..1461361 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| HKU360_RS07235 | - | 1461364..1461552 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| HKU360_RS07240 (HKU360_01491) | - | 1461583..1463028 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| HKU360_RS07245 (HKU360_01492) | - | 1462988..1464520 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| HKU360_RS07250 (HKU360_01493) | - | 1464536..1465813 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| HKU360_RS07255 (HKU360_01494) | - | 1465803..1466255 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| HKU360_RS07260 (HKU360_01495) | - | 1466345..1466761 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| HKU360_RS07265 (HKU360_01496) | - | 1466758..1466949 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| HKU360_RS07270 (HKU360_01497) | - | 1466939..1467790 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| HKU360_RS07275 (HKU360_01498) | - | 1467799..1468065 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| HKU360_RS10345 (HKU360_01499) | - | 1468062..1468229 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| HKU360_RS07280 (HKU360_01500) | - | 1468230..1469552 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| HKU360_RS07285 (HKU360_01501) | - | 1469549..1469824 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| HKU360_RS07290 (HKU360_01502) | - | 1470211..1472595 (-) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| HKU360_RS07295 (HKU360_01503) | - | 1472600..1474522 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| HKU360_RS07300 (HKU360_01504) | - | 1474565..1475122 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| HKU360_RS07305 (HKU360_01505) | - | 1475133..1475531 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| HKU360_RS07310 (HKU360_01506) | - | 1475535..1476689 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| HKU360_RS07315 (HKU360_01507) | - | 1476689..1476988 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| HKU360_RS07320 (HKU360_01508) | - | 1477076..1477279 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| HKU360_RS07330 (HKU360_01510) | - | 1477426..1477812 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| HKU360_RS07335 (HKU360_01511) | - | 1477809..1478012 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| HKU360_RS09970 (HKU360_01512) | - | 1478005..1478175 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| HKU360_RS07340 (HKU360_01513) | - | 1478172..1478447 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| HKU360_RS07345 (HKU360_01514) | - | 1478509..1478724 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| HKU360_RS07350 (HKU360_01515) | - | 1478772..1479185 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| HKU360_RS10350 (HKU360_01516) | - | 1479166..1479321 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| HKU360_RS07355 (HKU360_01517) | - | 1479647..1479997 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| HKU360_RS07360 (HKU360_01518) | - | 1480011..1480394 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HKU360_RS07365 (HKU360_01519) | - | 1480405..1480956 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| HKU360_RS07370 (HKU360_01520) | - | 1481073..1482152 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=130748 HKU360_RS07125 WP_002988813.1 1441519..1441698(-) (prx) [Streptococcus pyogenes strain HKU360]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=130748 HKU360_RS07125 WP_002988813.1 1441519..1441698(-) (prx) [Streptococcus pyogenes strain HKU360]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |