Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HKU360_RS05850 | Genome accession | NZ_CP009612 |
| Coordinates | 1192477..1192659 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain HKU360 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1192477..1237044 | 1192477..1192659 | within | 0 |
Gene organization within MGE regions
Location: 1192477..1237044
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HKU360_RS05850 (HKU360_01201) | prx | 1192477..1192659 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| HKU360_RS05855 (HKU360_01202) | entC3 | 1192772..1193554 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| HKU360_RS05860 (HKU360_01203) | - | 1193802..1194926 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| HKU360_RS05865 (HKU360_01204) | - | 1195062..1196279 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| HKU360_RS05875 (HKU360_01206) | - | 1196398..1196625 (-) | 228 | WP_003058873.1 | phage holin | - |
| HKU360_RS05880 (HKU360_01207) | - | 1196622..1196894 (-) | 273 | WP_019418840.1 | hypothetical protein | - |
| HKU360_RS05885 (HKU360_01208) | - | 1196904..1197521 (-) | 618 | WP_011017592.1 | DUF1366 domain-containing protein | - |
| HKU360_RS05890 (HKU360_01209) | - | 1197524..1197955 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| HKU360_RS05895 (HKU360_01210) | - | 1197967..1199877 (-) | 1911 | WP_038433819.1 | gp58-like family protein | - |
| HKU360_RS05900 (HKU360_01211) | - | 1199888..1200523 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| HKU360_RS05905 (HKU360_01212) | - | 1200523..1201578 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| HKU360_RS05910 (HKU360_01213) | - | 1201575..1203722 (-) | 2148 | WP_038433820.1 | phage tail spike protein | - |
| HKU360_RS05915 (HKU360_01214) | - | 1203719..1204426 (-) | 708 | WP_011527559.1 | distal tail protein Dit | - |
| HKU360_RS05920 (HKU360_01215) | - | 1204426..1208349 (-) | 3924 | WP_011527558.1 | phage tail tape measure protein | - |
| HKU360_RS10320 | - | 1208362..1208511 (-) | 150 | WP_021299462.1 | hypothetical protein | - |
| HKU360_RS05930 (HKU360_01216) | gpG | 1208559..1208885 (-) | 327 | WP_011017586.1 | phage tail assembly chaperone G | - |
| HKU360_RS05935 (HKU360_01217) | - | 1208938..1209546 (-) | 609 | WP_011017585.1 | major tail protein | - |
| HKU360_RS05940 (HKU360_01218) | - | 1209562..1209987 (-) | 426 | WP_011017584.1 | hypothetical protein | - |
| HKU360_RS05945 (HKU360_01219) | - | 1209984..1210361 (-) | 378 | WP_011527557.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| HKU360_RS05950 (HKU360_01220) | - | 1210358..1210705 (-) | 348 | WP_011017582.1 | phage head closure protein | - |
| HKU360_RS05955 (HKU360_01221) | - | 1210702..1211004 (-) | 303 | WP_011017581.1 | head-tail connector protein | - |
| HKU360_RS10530 | - | 1211007..1211135 (-) | 129 | WP_001118388.1 | hypothetical protein | - |
| HKU360_RS05960 (HKU360_01222) | - | 1211149..1212336 (-) | 1188 | WP_011017580.1 | phage major capsid protein | - |
| HKU360_RS05965 (HKU360_01223) | - | 1212361..1213026 (-) | 666 | WP_011017579.1 | head maturation protease, ClpP-related | - |
| HKU360_RS05970 (HKU360_01224) | - | 1213004..1214224 (-) | 1221 | WP_011017578.1 | phage portal protein | - |
| HKU360_RS05975 (HKU360_01225) | - | 1214258..1214482 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| HKU360_RS10325 (HKU360_01226) | - | 1214475..1214645 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| HKU360_RS05980 (HKU360_01227) | - | 1214642..1216396 (-) | 1755 | WP_024623442.1 | terminase large subunit | - |
| HKU360_RS05985 (HKU360_01228) | - | 1216400..1216630 (-) | 231 | WP_002985368.1 | hypothetical protein | - |
| HKU360_RS05990 (HKU360_01229) | - | 1216633..1217100 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| HKU360_RS05995 (HKU360_01230) | - | 1217271..1217609 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| HKU360_RS06000 (HKU360_01232) | - | 1217845..1218030 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| HKU360_RS06005 (HKU360_01233) | - | 1218082..1218459 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| HKU360_RS06010 (HKU360_01234) | - | 1218586..1219605 (-) | 1020 | WP_038433821.1 | DNA adenine methylase | - |
| HKU360_RS06015 (HKU360_01235) | - | 1220188..1220625 (-) | 438 | WP_011017574.1 | DUF1492 domain-containing protein | - |
| HKU360_RS06025 (HKU360_01237) | - | 1221068..1221793 (-) | 726 | WP_011017573.1 | DUF1642 domain-containing protein | - |
| HKU360_RS06030 (HKU360_01238) | - | 1221841..1222605 (-) | 765 | WP_021299463.1 | DNA-methyltransferase | - |
| HKU360_RS06035 (HKU360_01239) | - | 1222595..1223077 (-) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| HKU360_RS06040 (HKU360_01240) | - | 1223081..1223365 (-) | 285 | WP_011017570.1 | hypothetical protein | - |
| HKU360_RS06045 (HKU360_01241) | - | 1223362..1223775 (-) | 414 | WP_011017569.1 | YopX family protein | - |
| HKU360_RS06050 (HKU360_01242) | - | 1223785..1224054 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| HKU360_RS06055 (HKU360_01243) | - | 1224051..1224236 (-) | 186 | WP_011527551.1 | hypothetical protein | - |
| HKU360_RS06060 (HKU360_01244) | - | 1224229..1224510 (-) | 282 | WP_011527550.1 | nucleotide modification associated domain-containing protein | - |
| HKU360_RS06065 (HKU360_01246) | - | 1224635..1224991 (-) | 357 | WP_011527549.1 | hypothetical protein | - |
| HKU360_RS06070 (HKU360_01247) | - | 1224975..1225295 (-) | 321 | WP_011527548.1 | VRR-NUC domain-containing protein | - |
| HKU360_RS06075 (HKU360_01248) | - | 1225292..1225705 (-) | 414 | WP_011527547.1 | hypothetical protein | - |
| HKU360_RS06080 (HKU360_01249) | - | 1225967..1227442 (-) | 1476 | WP_011527546.1 | phage/plasmid primase, P4 family | - |
| HKU360_RS06085 (HKU360_01250) | - | 1227432..1228244 (-) | 813 | WP_011527545.1 | bifunctional DNA primase/polymerase | - |
| HKU360_RS06090 (HKU360_01251) | - | 1228247..1228705 (-) | 459 | WP_011527544.1 | DUF669 domain-containing protein | - |
| HKU360_RS06095 (HKU360_01252) | - | 1228721..1229950 (-) | 1230 | WP_038433823.1 | DEAD/DEAH box helicase | - |
| HKU360_RS06100 (HKU360_01254) | - | 1230052..1230744 (-) | 693 | WP_011527542.1 | AAA family ATPase | - |
| HKU360_RS06105 (HKU360_01255) | - | 1230731..1231021 (-) | 291 | WP_024623417.1 | hypothetical protein | - |
| HKU360_RS06110 (HKU360_01256) | - | 1231152..1231334 (-) | 183 | WP_008087492.1 | hypothetical protein | - |
| HKU360_RS06115 (HKU360_01257) | - | 1231322..1231534 (-) | 213 | WP_011527540.1 | hypothetical protein | - |
| HKU360_RS10330 (HKU360_01258) | - | 1231544..1231684 (-) | 141 | WP_011527539.1 | hypothetical protein | - |
| HKU360_RS06120 (HKU360_01259) | - | 1231681..1231926 (-) | 246 | WP_011527538.1 | hypothetical protein | - |
| HKU360_RS06125 (HKU360_01261) | - | 1232191..1232403 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| HKU360_RS06130 (HKU360_01262) | - | 1232605..1233360 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| HKU360_RS06135 (HKU360_01263) | - | 1233372..1233890 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| HKU360_RS06140 (HKU360_01264) | - | 1234014..1235156 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| HKU360_RS06145 (HKU360_01265) | - | 1235245..1235520 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| HKU360_RS06150 (HKU360_01266) | - | 1235619..1236206 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| HKU360_RS06155 (HKU360_01267) | - | 1236184..1237026 (-) | 843 | WP_024623416.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=130741 HKU360_RS05850 WP_011528776.1 1192477..1192659(-) (prx) [Streptococcus pyogenes strain HKU360]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=130741 HKU360_RS05850 WP_011528776.1 1192477..1192659(-) (prx) [Streptococcus pyogenes strain HKU360]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |