Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABU16_RS17090 | Genome accession | NZ_CP011882 |
| Coordinates | 3327496..3327669 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain TO-A JPC | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3322496..3332669
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABU16_RS17075 (ABU16_3393) | gcvT | 3323295..3324383 (-) | 1089 | WP_003230205.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABU16_RS17080 (ABU16_3394) | yqhH | 3324825..3326498 (+) | 1674 | WP_003230203.1 | SNF2-related protein | - |
| ABU16_RS17085 (ABU16_3395) | yqhG | 3326519..3327313 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| ABU16_RS17090 (ABU16_3396) | sinI | 3327496..3327669 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| ABU16_RS17095 (ABU16_3397) | sinR | 3327703..3328038 (+) | 336 | WP_080287687.1 | transcriptional regulator SinR | Regulator |
| ABU16_RS17100 (ABU16_3398) | tasA | 3328131..3328916 (-) | 786 | WP_003230183.1 | biofilm matrix protein TasA | - |
| ABU16_RS17105 (ABU16_3399) | sipW | 3328980..3329552 (-) | 573 | WP_003230181.1 | signal peptidase I | - |
| ABU16_RS17110 (ABU16_3400) | tapA | 3329536..3330297 (-) | 762 | WP_003230180.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABU16_RS17115 (ABU16_3401) | yqzG | 3330569..3330895 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| ABU16_RS17120 (ABU16_3402) | spoIIT | 3330937..3331116 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| ABU16_RS17125 (ABU16_3403) | comGG | 3331187..3331561 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| ABU16_RS17130 (ABU16_3404) | comGF | 3331562..3331945 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| ABU16_RS17135 (ABU16_3405) | comGE | 3331971..3332318 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=129650 ABU16_RS17090 WP_003230187.1 3327496..3327669(+) (sinI) [Bacillus subtilis strain TO-A JPC]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=129650 ABU16_RS17090 WP_003230187.1 3327496..3327669(+) (sinI) [Bacillus subtilis strain TO-A JPC]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |