Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DP15_RS01150 | Genome accession | NZ_CP008926 |
| Coordinates | 246838..247020 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain ATCC 19615 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 246838..292711 | 246838..247020 | within | 0 |
Gene organization within MGE regions
Location: 246838..292711
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DP15_RS01150 (DP15_232) | prx | 246838..247020 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| DP15_RS01160 (DP15_234) | - | 247366..247941 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| DP15_RS01165 (DP15_235) | spek | 248417..249196 (-) | 780 | WP_038432391.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DP15_RS10290 | - | 249500..250364 (-) | 865 | Protein_230 | hypothetical protein | - |
| DP15_RS01175 (DP15_237) | - | 250352..250875 (-) | 524 | Protein_231 | Panacea domain-containing protein | - |
| DP15_RS01180 (DP15_238) | - | 251015..252223 (-) | 1209 | WP_014411848.1 | glucosaminidase domain-containing protein | - |
| DP15_RS01190 (DP15_240) | - | 252339..252566 (-) | 228 | WP_003058873.1 | phage holin | - |
| DP15_RS01195 (DP15_241) | - | 252563..252838 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DP15_RS01200 (DP15_242) | - | 252848..253486 (-) | 639 | WP_023610893.1 | hypothetical protein | - |
| DP15_RS01205 (DP15_243) | - | 253489..253917 (-) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| DP15_RS01210 (DP15_244) | - | 253929..255815 (-) | 1887 | WP_014411851.1 | gp58-like family protein | - |
| DP15_RS01215 (DP15_245) | hylP | 255828..256850 (-) | 1023 | WP_014411852.1 | hyaluronidase HylP | - |
| DP15_RS01220 (DP15_246) | - | 256847..258991 (-) | 2145 | WP_014411853.1 | phage tail spike protein | - |
| DP15_RS01225 (DP15_247) | - | 258988..259695 (-) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| DP15_RS01230 (DP15_248) | - | 259695..263618 (-) | 3924 | WP_014411855.1 | phage tail tape measure protein | - |
| DP15_RS09915 (DP15_249) | - | 263631..263798 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| DP15_RS01240 (DP15_250) | gpG | 263828..264154 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| DP15_RS01245 (DP15_251) | - | 264207..264815 (-) | 609 | WP_014411858.1 | major tail protein | - |
| DP15_RS01250 (DP15_252) | - | 264832..265257 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| DP15_RS01255 (DP15_253) | - | 265254..265631 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DP15_RS01260 (DP15_254) | - | 265628..265975 (-) | 348 | WP_002985351.1 | phage head closure protein | - |
| DP15_RS01265 (DP15_255) | - | 265972..266274 (-) | 303 | WP_014411860.1 | head-tail connector protein | - |
| DP15_RS09920 | - | 266277..266423 (-) | 147 | WP_023610896.1 | hypothetical protein | - |
| DP15_RS01270 (DP15_256) | - | 266410..267612 (-) | 1203 | WP_014411862.1 | phage major capsid protein | - |
| DP15_RS01275 (DP15_257) | - | 267638..268303 (-) | 666 | WP_023610933.1 | head maturation protease, ClpP-related | - |
| DP15_RS01280 (DP15_258) | - | 268281..269501 (-) | 1221 | WP_014411863.1 | phage portal protein | - |
| DP15_RS01285 (DP15_259) | - | 269535..269759 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| DP15_RS09925 (DP15_260) | - | 269752..269922 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| DP15_RS01290 (DP15_261) | - | 269919..271673 (-) | 1755 | WP_014411864.1 | terminase large subunit | - |
| DP15_RS01295 (DP15_262) | - | 271688..272155 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DP15_RS01300 (DP15_263) | - | 272326..272664 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DP15_RS01310 (DP15_264) | - | 273249..273689 (-) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DP15_RS01315 (DP15_265) | - | 273965..274336 (-) | 372 | WP_014411868.1 | hypothetical protein | - |
| DP15_RS01320 (DP15_266) | - | 274333..275043 (-) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DP15_RS01325 (DP15_267) | - | 275046..275678 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DP15_RS01330 (DP15_268) | - | 275680..275964 (-) | 285 | WP_014411870.1 | hypothetical protein | - |
| DP15_RS01335 (DP15_269) | - | 275961..276365 (-) | 405 | WP_014411871.1 | YopX family protein | - |
| DP15_RS01340 (DP15_270) | - | 276375..276644 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| DP15_RS01345 (DP15_271) | - | 276641..276925 (-) | 285 | WP_014411872.1 | DUF3310 domain-containing protein | - |
| DP15_RS10225 (DP15_272) | - | 276919..277159 (-) | 241 | Protein_266 | hypothetical protein | - |
| DP15_RS01350 (DP15_273) | - | 277156..277512 (-) | 357 | WP_038432396.1 | hypothetical protein | - |
| DP15_RS01355 (DP15_274) | - | 277496..277816 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| DP15_RS01360 (DP15_275) | - | 277813..278226 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| DP15_RS01365 (DP15_276) | - | 278488..279963 (-) | 1476 | WP_014411876.1 | DNA primase family protein | - |
| DP15_RS01370 (DP15_277) | - | 279953..280765 (-) | 813 | WP_014411877.1 | bifunctional DNA primase/polymerase | - |
| DP15_RS01375 (DP15_278) | - | 280768..281226 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DP15_RS01380 (DP15_279) | - | 281242..282471 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| DP15_RS01385 (DP15_280) | - | 282573..283253 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DP15_RS01390 (DP15_281) | - | 283254..283736 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DP15_RS01395 (DP15_282) | - | 283884..284198 (-) | 315 | WP_014411879.1 | helix-turn-helix domain-containing protein | - |
| DP15_RS10165 (DP15_283) | - | 284214..284348 (-) | 135 | WP_012560975.1 | hypothetical protein | - |
| DP15_RS01400 (DP15_284) | - | 284350..284661 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DP15_RS01405 (DP15_285) | - | 284739..284924 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DP15_RS01410 (DP15_286) | - | 285091..285330 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DP15_RS01415 (DP15_288) | - | 285481..285690 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DP15_RS01425 (DP15_290) | - | 285943..286749 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DP15_RS01430 (DP15_291) | - | 286961..287200 (-) | 240 | WP_014411882.1 | helix-turn-helix transcriptional regulator | - |
| DP15_RS01435 (DP15_292) | - | 287294..287893 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| DP15_RS09930 (DP15_293) | - | 287923..288081 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| DP15_RS01440 (DP15_295) | - | 288454..289242 (+) | 789 | WP_014411883.1 | S24 family peptidase | - |
| DP15_RS01445 (DP15_296) | - | 289252..289557 (+) | 306 | WP_011106738.1 | membrane protein | - |
| DP15_RS01450 (DP15_297) | - | 289680..290822 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| DP15_RS01455 (DP15_298) | - | 290912..291187 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DP15_RS01460 (DP15_299) | - | 291286..291873 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| DP15_RS01465 (DP15_300) | - | 291851..292693 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=125763 DP15_RS01150 WP_011017964.1 246838..247020(-) (prx) [Streptococcus pyogenes strain ATCC 19615]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=125763 DP15_RS01150 WP_011017964.1 246838..247020(-) (prx) [Streptococcus pyogenes strain ATCC 19615]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |