Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SP5448_RS04440 | Genome accession | NZ_CP008776 |
| Coordinates | 854661..854849 (+) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 5448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 816123..856966 | 854661..854849 | within | 0 |
Gene organization within MGE regions
Location: 816123..856966
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP5448_RS04160 (SP5448_04345) | - | 816123..816743 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| SP5448_RS04165 (SP5448_04350) | - | 817106..818194 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| SP5448_RS04170 (SP5448_04355) | - | 818315..819208 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| SP5448_RS04175 (SP5448_04360) | - | 819244..820068 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| SP5448_RS09305 | - | 820425..820583 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| SP5448_RS04180 (SP5448_04375) | - | 820613..821212 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| SP5448_RS04185 (SP5448_04380) | - | 821266..821475 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| SP5448_RS04190 (SP5448_04385) | - | 821464..821850 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| SP5448_RS04195 (SP5448_04390) | - | 821924..822124 (+) | 201 | WP_002992770.1 | helix-turn-helix transcriptional regulator | - |
| SP5448_RS04200 (SP5448_04395) | - | 822234..822443 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| SP5448_RS09840 | - | 822574..822813 (-) | 240 | WP_227874181.1 | hypothetical protein | - |
| SP5448_RS09845 | - | 823047..823235 (+) | 189 | Protein_791 | XRE family transcriptional regulator | - |
| SP5448_RS04210 (SP5448_04405) | - | 823249..824079 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SP5448_RS04215 (SP5448_04410) | - | 824066..824848 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| SP5448_RS04220 (SP5448_04420) | - | 824989..825342 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| SP5448_RS04225 (SP5448_04425) | - | 825323..825577 (+) | 255 | WP_011285578.1 | hypothetical protein | - |
| SP5448_RS04230 (SP5448_04430) | - | 825599..826081 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| SP5448_RS04235 (SP5448_04435) | - | 826082..826756 (+) | 675 | WP_011285576.1 | ERF family protein | - |
| SP5448_RS04240 (SP5448_04440) | ssb | 826749..827174 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| SP5448_RS04245 (SP5448_04445) | - | 827180..827383 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| SP5448_RS04250 (SP5448_04450) | - | 827383..827823 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SP5448_RS04255 (SP5448_04455) | - | 827820..828176 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| SP5448_RS10000 (SP5448_04460) | - | 828173..828418 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| SP5448_RS04265 (SP5448_04465) | - | 828418..828654 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| SP5448_RS09730 | - | 828651..828821 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| SP5448_RS04270 (SP5448_04475) | - | 828818..829102 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| SP5448_RS04275 (SP5448_04480) | - | 829104..829736 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| SP5448_RS04280 (SP5448_04485) | - | 829739..830263 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| SP5448_RS04285 (SP5448_04490) | - | 830260..830526 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| SP5448_RS04290 (SP5448_04495) | - | 830812..831246 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SP5448_RS04295 (SP5448_04500) | - | 831856..832236 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| SP5448_RS04300 (SP5448_04505) | - | 832226..833500 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| SP5448_RS04305 (SP5448_04510) | - | 833500..834825 (+) | 1326 | WP_011285570.1 | phage portal protein | - |
| SP5448_RS04310 (SP5448_04515) | - | 834794..835702 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| SP5448_RS04315 (SP5448_04520) | - | 835709..835978 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| SP5448_RS09950 | - | 835980..836114 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| SP5448_RS04320 (SP5448_04530) | - | 836223..836792 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| SP5448_RS04325 (SP5448_04535) | - | 836811..837701 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| SP5448_RS04330 (SP5448_04540) | - | 837714..838007 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| SP5448_RS04335 (SP5448_04545) | - | 838021..838365 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| SP5448_RS04340 (SP5448_04550) | - | 838362..838673 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| SP5448_RS04345 (SP5448_04555) | - | 838670..839065 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| SP5448_RS04350 (SP5448_04560) | - | 839067..839477 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| SP5448_RS04355 (SP5448_04565) | - | 839489..839995 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| SP5448_RS04360 (SP5448_04570) | - | 840008..840325 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| SP5448_RS04365 (SP5448_04575) | - | 840298..840756 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| SP5448_RS04370 (SP5448_04580) | - | 840749..842554 (+) | 1806 | WP_011054802.1 | tail protein | - |
| SP5448_RS04375 (SP5448_04585) | - | 842555..844039 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| SP5448_RS04380 (SP5448_04590) | - | 844040..847480 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| SP5448_RS04385 (SP5448_04595) | - | 847485..849347 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| SP5448_RS04390 (SP5448_04600) | - | 849358..849705 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| SP5448_RS09955 | - | 849719..849841 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| SP5448_RS04400 (SP5448_04610) | - | 849855..850178 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| SP5448_RS04405 (SP5448_04615) | - | 850178..850510 (+) | 333 | WP_011285562.1 | phage holin | - |
| SP5448_RS04410 (SP5448_04620) | - | 850512..851276 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| SP5448_RS04415 (SP5448_04625) | - | 851288..851890 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| SP5448_RS04420 (SP5448_04630) | - | 851901..852674 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| SP5448_RS04425 (SP5448_04635) | - | 852684..852905 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| SP5448_RS04430 (SP5448_04640) | - | 852905..853564 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| SP5448_RS04435 (SP5448_04645) | speA | 853686..854441 (-) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| SP5448_RS04440 (SP5448_04650) | prx | 854661..854849 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| SP5448_RS04445 (SP5448_04655) | - | 855440..856054 (+) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| SP5448_RS04450 (SP5448_04660) | - | 856181..856966 (-) | 786 | WP_010922378.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=124143 SP5448_RS04440 WP_011285559.1 854661..854849(+) (prx) [Streptococcus pyogenes strain 5448]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=124143 SP5448_RS04440 WP_011285559.1 854661..854849(+) (prx) [Streptococcus pyogenes strain 5448]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |