Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SP5448_RS03610 | Genome accession | NZ_CP008776 |
| Coordinates | 692926..693108 (+) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 5448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 658098..693108 | 692926..693108 | within | 0 |
Gene organization within MGE regions
Location: 658098..693108
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP5448_RS03330 (SP5448_03450) | - | 658116..658958 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| SP5448_RS03335 (SP5448_03455) | - | 658936..659523 (+) | 588 | WP_010922482.1 | YpmS family protein | - |
| SP5448_RS03340 (SP5448_03460) | - | 659622..659897 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SP5448_RS03345 (SP5448_03465) | - | 659987..661129 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| SP5448_RS03350 (SP5448_03470) | - | 661253..661519 (-) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| SP5448_RS03355 (SP5448_03475) | - | 661531..661911 (-) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SP5448_RS03360 (SP5448_03480) | - | 661915..662262 (-) | 348 | WP_011285631.1 | helix-turn-helix transcriptional regulator | - |
| SP5448_RS09285 | - | 662685..662780 (-) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| SP5448_RS03365 (SP5448_03495) | - | 663416..663607 (+) | 192 | WP_002993390.1 | hypothetical protein | - |
| SP5448_RS03370 (SP5448_03500) | - | 663619..664335 (+) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| SP5448_RS03375 (SP5448_03505) | - | 664367..664633 (+) | 267 | WP_010922204.1 | hypothetical protein | - |
| SP5448_RS03380 (SP5448_03510) | - | 664568..665374 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| SP5448_RS03385 (SP5448_03520) | - | 665516..665755 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| SP5448_RS03390 (SP5448_03525) | - | 665922..666107 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| SP5448_RS03395 (SP5448_03530) | - | 666185..666496 (+) | 312 | WP_002990080.1 | hypothetical protein | - |
| SP5448_RS03400 (SP5448_03535) | - | 666498..666683 (+) | 186 | WP_011285628.1 | hypothetical protein | - |
| SP5448_RS09830 (SP5448_03540) | - | 666783..667022 (+) | 240 | WP_002985390.1 | hypothetical protein | - |
| SP5448_RS03410 (SP5448_03545) | - | 667167..667556 (+) | 390 | WP_011285627.1 | DnaD domain protein | - |
| SP5448_RS03415 (SP5448_03550) | - | 667537..667770 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| SP5448_RS09620 | - | 667767..667907 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| SP5448_RS03420 (SP5448_03560) | - | 667916..668122 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| SP5448_RS03425 (SP5448_03565) | - | 668178..668507 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| SP5448_RS03430 (SP5448_03570) | - | 668510..669439 (+) | 930 | WP_011285626.1 | recombinase RecT | - |
| SP5448_RS03435 (SP5448_03575) | - | 669436..670233 (+) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SP5448_RS09720 | - | 670243..670410 (+) | 168 | WP_011285624.1 | hypothetical protein | - |
| SP5448_RS03440 (SP5448_03585) | - | 670588..670929 (+) | 342 | WP_002988364.1 | hypothetical protein | - |
| SP5448_RS03445 (SP5448_03590) | - | 670926..671438 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| SP5448_RS03450 (SP5448_03595) | - | 671522..671791 (+) | 270 | WP_002988369.1 | hypothetical protein | - |
| SP5448_RS03455 (SP5448_03600) | - | 671793..672428 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| SP5448_RS03460 (SP5448_03605) | - | 672696..673115 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| SP5448_RS03465 (SP5448_03610) | - | 673224..673568 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| SP5448_RS03470 (SP5448_03620) | - | 673717..674073 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| SP5448_RS03475 (SP5448_03625) | - | 674070..675338 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| SP5448_RS03480 (SP5448_03630) | - | 675331..676824 (+) | 1494 | WP_015446231.1 | hypothetical protein | - |
| SP5448_RS03485 (SP5448_03635) | - | 676830..677054 (+) | 225 | WP_010922466.1 | hypothetical protein | - |
| SP5448_RS03490 | - | 677104..677283 (+) | 180 | WP_015055972.1 | hypothetical protein | - |
| SP5448_RS03495 (SP5448_03645) | - | 677276..677542 (+) | 267 | WP_010922464.1 | hypothetical protein | - |
| SP5448_RS03500 (SP5448_03650) | - | 677652..679067 (+) | 1416 | WP_011285619.1 | terminase | - |
| SP5448_RS03505 (SP5448_03655) | - | 679148..679609 (+) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| SP5448_RS03510 (SP5448_03660) | - | 679634..680545 (+) | 912 | WP_010922461.1 | phage major capsid protein | - |
| SP5448_RS03515 (SP5448_03665) | - | 680545..680745 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| SP5448_RS03520 (SP5448_03670) | - | 680755..681177 (+) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SP5448_RS03525 (SP5448_03675) | - | 681137..681475 (+) | 339 | WP_011285617.1 | hypothetical protein | - |
| SP5448_RS03530 (SP5448_03680) | - | 681468..681704 (+) | 237 | WP_010922457.1 | hypothetical protein | - |
| SP5448_RS03535 (SP5448_03685) | - | 681705..682040 (+) | 336 | WP_011285616.1 | hypothetical protein | - |
| SP5448_RS03540 (SP5448_03690) | - | 682052..682645 (+) | 594 | WP_010922456.1 | tail protein | - |
| SP5448_RS03545 (SP5448_03695) | - | 682656..682919 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| SP5448_RS03550 (SP5448_03700) | - | 682934..683305 (+) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| SP5448_RS03555 (SP5448_03705) | - | 683305..685662 (+) | 2358 | WP_010922453.1 | hypothetical protein | - |
| SP5448_RS03560 (SP5448_03710) | - | 685659..686354 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| SP5448_RS03565 (SP5448_03715) | - | 686351..688219 (+) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| SP5448_RS03570 (SP5448_03720) | - | 688231..688668 (+) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| SP5448_RS03575 (SP5448_03725) | - | 688665..689282 (+) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| SP5448_RS03580 (SP5448_03730) | - | 689292..689567 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| SP5448_RS03585 (SP5448_03735) | - | 689564..689791 (+) | 228 | WP_003058873.1 | phage holin | - |
| SP5448_RS03595 (SP5448_03745) | - | 689907..691112 (+) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| SP5448_RS03600 (SP5448_03750) | - | 691182..691616 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| SP5448_RS03605 (SP5448_03755) | sda3 | 691887..692687 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SP5448_RS03610 (SP5448_03760) | prx | 692926..693108 (+) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=124139 SP5448_RS03610 WP_011017964.1 692926..693108(+) (prx) [Streptococcus pyogenes strain 5448]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=124139 SP5448_RS03610 WP_011017964.1 692926..693108(+) (prx) [Streptococcus pyogenes strain 5448]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |