Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SP5448_RS02375 | Genome accession | NZ_CP008776 |
| Coordinates | 453541..453720 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 5448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 413104..453720 | 453541..453720 | within | 0 |
Gene organization within MGE regions
Location: 413104..453720
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP5448_RS02130 (SP5448_02205) | - | 413104..414183 (-) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
| SP5448_RS02135 (SP5448_02210) | - | 414300..414851 (-) | 552 | WP_002988670.1 | hypothetical protein | - |
| SP5448_RS02140 (SP5448_02215) | - | 414862..415245 (-) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SP5448_RS02145 (SP5448_02220) | - | 415259..415609 (-) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| SP5448_RS09690 | - | 415935..416090 (+) | 156 | WP_002988678.1 | hypothetical protein | - |
| SP5448_RS02150 (SP5448_02230) | - | 416071..416484 (-) | 414 | WP_002988681.1 | hypothetical protein | - |
| SP5448_RS02155 (SP5448_02235) | - | 416532..416747 (+) | 216 | WP_002988684.1 | hypothetical protein | - |
| SP5448_RS02160 (SP5448_02240) | - | 416809..417084 (+) | 276 | WP_002988687.1 | hypothetical protein | - |
| SP5448_RS09235 | - | 417081..417251 (+) | 171 | WP_002988693.1 | hypothetical protein | - |
| SP5448_RS02165 (SP5448_02250) | - | 417244..417447 (+) | 204 | WP_002988697.1 | hypothetical protein | - |
| SP5448_RS02170 (SP5448_02255) | - | 417444..417830 (+) | 387 | WP_002988700.1 | hypothetical protein | - |
| SP5448_RS02175 (SP5448_02265) | - | 417976..418179 (+) | 204 | WP_002988705.1 | hypothetical protein | - |
| SP5448_RS02180 (SP5448_02270) | - | 418267..418566 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| SP5448_RS02185 (SP5448_02275) | - | 418566..419720 (+) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| SP5448_RS02190 (SP5448_02280) | - | 419724..420122 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| SP5448_RS02195 (SP5448_02285) | - | 420133..420690 (+) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| SP5448_RS02200 (SP5448_02290) | - | 420733..422655 (+) | 1923 | WP_002988723.1 | DNA polymerase | - |
| SP5448_RS02205 (SP5448_02295) | - | 422660..425044 (+) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| SP5448_RS02210 (SP5448_02300) | - | 425431..425706 (+) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| SP5448_RS02215 (SP5448_02305) | - | 425703..427025 (+) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| SP5448_RS09695 | - | 427026..427193 (+) | 168 | WP_002988735.1 | hypothetical protein | - |
| SP5448_RS02220 (SP5448_02315) | - | 427190..427456 (+) | 267 | WP_002988738.1 | hypothetical protein | - |
| SP5448_RS02225 (SP5448_02320) | - | 427465..428316 (+) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| SP5448_RS02230 (SP5448_02325) | - | 428306..428497 (+) | 192 | WP_002988743.1 | hypothetical protein | - |
| SP5448_RS02235 (SP5448_02330) | - | 428494..428910 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| SP5448_RS02240 (SP5448_02335) | - | 429000..429452 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| SP5448_RS02245 (SP5448_02340) | - | 429442..430719 (+) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| SP5448_RS02250 (SP5448_02345) | - | 430735..432267 (+) | 1533 | WP_002988758.1 | phage portal protein | - |
| SP5448_RS02255 (SP5448_02350) | - | 432227..433672 (+) | 1446 | WP_015446273.1 | minor capsid protein | - |
| SP5448_RS02260 (SP5448_02355) | - | 433703..433891 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| SP5448_RS02265 (SP5448_02360) | - | 433894..434160 (+) | 267 | WP_002988765.1 | hypothetical protein | - |
| SP5448_RS02270 (SP5448_02365) | - | 434316..434885 (+) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| SP5448_RS02275 (SP5448_02370) | - | 434898..435785 (+) | 888 | WP_002988771.1 | hypothetical protein | - |
| SP5448_RS02280 (SP5448_02375) | - | 435797..436153 (+) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| SP5448_RS02285 (SP5448_02380) | - | 436164..436442 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| SP5448_RS02290 (SP5448_02385) | - | 436439..436783 (+) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SP5448_RS02295 (SP5448_02390) | - | 436787..437146 (+) | 360 | WP_002988782.1 | hypothetical protein | - |
| SP5448_RS02300 (SP5448_02395) | - | 437158..437757 (+) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| SP5448_RS02305 (SP5448_02400) | - | 437811..438266 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| SP5448_RS02310 (SP5448_02405) | - | 438341..438574 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| SP5448_RS02315 (SP5448_02410) | - | 438589..442971 (+) | 4383 | WP_002988786.1 | tape measure protein | - |
| SP5448_RS02320 (SP5448_02415) | - | 442983..443825 (+) | 843 | WP_002988788.1 | phage tail family protein | - |
| SP5448_RS02325 (SP5448_02420) | - | 443835..445817 (+) | 1983 | WP_002988790.1 | phage tail protein | - |
| SP5448_RS02330 (SP5448_02425) | - | 445814..446869 (+) | 1056 | WP_002988439.1 | hypothetical protein | - |
| SP5448_RS02335 (SP5448_02430) | - | 446869..447504 (+) | 636 | WP_002988442.1 | hypothetical protein | - |
| SP5448_RS02340 (SP5448_02435) | - | 447515..449422 (+) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| SP5448_RS09240 | - | 449431..449592 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| SP5448_RS02345 (SP5448_02445) | - | 449595..450215 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| SP5448_RS02350 (SP5448_02450) | - | 450226..450525 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| SP5448_RS02355 (SP5448_02455) | - | 450522..450707 (+) | 186 | WP_002988802.1 | holin | - |
| SP5448_RS02365 (SP5448_02465) | - | 450818..452014 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| SP5448_RS02370 (SP5448_02470) | sda1 | 452130..453302 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| SP5448_RS02375 (SP5448_02475) | prx | 453541..453720 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=124132 SP5448_RS02375 WP_002988813.1 453541..453720(+) (prx) [Streptococcus pyogenes strain 5448]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=124132 SP5448_RS02375 WP_002988813.1 453541..453720(+) (prx) [Streptococcus pyogenes strain 5448]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |