Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FE90_RS03280 | Genome accession | NZ_CP008695 |
| Coordinates | 612042..612230 (+) | Length | 62 a.a. |
| NCBI ID | WP_032461628.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain M23ND | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 571772..621379 | 612042..612230 | within | 0 |
Gene organization within MGE regions
Location: 571772..621379
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FE90_RS03000 (FE90_0589) | - | 571772..572392 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| FE90_RS03005 (FE90_0590) | - | 572756..573844 (-) | 1089 | WP_038433317.1 | site-specific integrase | - |
| FE90_RS03010 (FE90_0592) | - | 574094..574903 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FE90_RS03015 (FE90_0593) | - | 574916..575740 (-) | 825 | WP_038433318.1 | XRE family transcriptional regulator | - |
| FE90_RS09965 (FE90_0594) | - | 576096..576245 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| FE90_RS03020 (FE90_0595) | - | 576231..576446 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| FE90_RS09970 (FE90_0596) | - | 576505..576663 (+) | 159 | WP_080286776.1 | hypothetical protein | - |
| FE90_RS03025 (FE90_0597) | - | 576762..577403 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| FE90_RS03030 (FE90_0598) | - | 577455..577655 (+) | 201 | WP_038433319.1 | helix-turn-helix domain-containing protein | - |
| FE90_RS03035 (FE90_0599) | - | 577786..578025 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| FE90_RS03040 (FE90_0600) | - | 578192..578377 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| FE90_RS03045 (FE90_0601) | - | 578456..578752 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| FE90_RS10230 (FE90_0602) | - | 578749..578883 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| FE90_RS03050 (FE90_0603) | - | 578899..579213 (+) | 315 | WP_023610888.1 | helix-turn-helix domain-containing protein | - |
| FE90_RS03055 (FE90_0604) | - | 579227..580057 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FE90_RS03060 (FE90_0605) | - | 580044..580637 (+) | 594 | Protein_586 | ATP-binding protein | - |
| FE90_RS03065 (FE90_0606) | - | 580689..581042 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| FE90_RS03070 (FE90_0607) | - | 581023..581277 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| FE90_RS03075 (FE90_0608) | - | 581299..581781 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| FE90_RS03080 (FE90_0609) | - | 581782..582456 (+) | 675 | WP_038433320.1 | ERF family protein | - |
| FE90_RS03085 (FE90_0610) | ssb | 582449..582940 (+) | 492 | WP_038433322.1 | single-stranded DNA-binding protein | Machinery gene |
| FE90_RS03090 | - | 582946..583149 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| FE90_RS03095 (FE90_0611) | - | 583149..583589 (+) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FE90_RS03100 (FE90_0612) | - | 583586..583942 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| FE90_RS10265 | - | 583939..584190 (+) | 252 | WP_032459778.1 | hypothetical protein | - |
| FE90_RS03110 (FE90_0613) | - | 584184..584468 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| FE90_RS03115 (FE90_0614) | - | 584465..584734 (+) | 270 | WP_038433325.1 | hypothetical protein | - |
| FE90_RS03120 (FE90_0615) | - | 584748..585134 (+) | 387 | WP_038433326.1 | YopX family protein | - |
| FE90_RS03125 | - | 585131..585415 (+) | 285 | WP_011017570.1 | hypothetical protein | - |
| FE90_RS03130 (FE90_0616) | - | 585419..585903 (+) | 485 | Protein_600 | class I SAM-dependent methyltransferase | - |
| FE90_RS03135 (FE90_0617) | - | 585907..586134 (+) | 228 | WP_021340166.1 | hypothetical protein | - |
| FE90_RS03140 (FE90_0618) | - | 586159..586344 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| FE90_RS03145 (FE90_0619) | - | 586631..587134 (+) | 504 | WP_032461638.1 | DUF1642 domain-containing protein | - |
| FE90_RS09975 | - | 587131..587301 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| FE90_RS03150 (FE90_0621) | - | 587584..588018 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FE90_RS03155 (FE90_0622) | - | 588611..588952 (+) | 342 | WP_021340284.1 | HNH endonuclease | - |
| FE90_RS03160 (FE90_0623) | - | 589120..589587 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| FE90_RS03165 (FE90_0624) | - | 589602..591356 (+) | 1755 | WP_038433329.1 | terminase large subunit | - |
| FE90_RS09980 (FE90_0625) | - | 591353..591523 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| FE90_RS03170 (FE90_0626) | - | 591516..591740 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| FE90_RS03175 (FE90_0627) | - | 591774..592994 (+) | 1221 | WP_038433129.1 | phage portal protein | - |
| FE90_RS03180 (FE90_0628) | - | 592972..593637 (+) | 666 | WP_021341143.1 | head maturation protease, ClpP-related | - |
| FE90_RS03185 (FE90_0629) | - | 593661..594845 (+) | 1185 | WP_029714355.1 | phage major capsid protein | - |
| FE90_RS10235 (FE90_0630) | - | 594859..594987 (+) | 129 | WP_021341089.1 | hypothetical protein | - |
| FE90_RS03190 (FE90_0631) | - | 594990..595292 (+) | 303 | WP_021341088.1 | head-tail connector protein | - |
| FE90_RS03195 (FE90_0632) | - | 595289..595636 (+) | 348 | WP_029714354.1 | phage head closure protein | - |
| FE90_RS03200 (FE90_0633) | - | 595633..596010 (+) | 378 | WP_021340627.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FE90_RS03205 (FE90_0634) | - | 596007..596432 (+) | 426 | WP_021341057.1 | hypothetical protein | - |
| FE90_RS03210 (FE90_0635) | - | 596449..597060 (+) | 612 | WP_021341058.1 | major tail protein | - |
| FE90_RS03215 (FE90_0636) | gpG | 597113..597439 (+) | 327 | WP_021733367.1 | phage tail assembly chaperone G | - |
| FE90_RS09885 (FE90_0637) | - | 597487..597636 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| FE90_RS03225 (FE90_0638) | - | 597649..601572 (+) | 3924 | WP_038433133.1 | phage tail tape measure protein | - |
| FE90_RS03230 (FE90_0639) | - | 601572..602279 (+) | 708 | WP_024623478.1 | distal tail protein Dit | - |
| FE90_RS03235 (FE90_0640) | - | 602276..604420 (+) | 2145 | WP_038433331.1 | phage tail spike protein | - |
| FE90_RS03240 (FE90_0641) | - | 604417..605421 (+) | 1005 | WP_038433336.1 | hyaluronoglucosaminidase | - |
| FE90_RS03245 (FE90_0642) | - | 605437..607455 (+) | 2019 | WP_052153463.1 | gp58-like family protein | - |
| FE90_RS09985 (FE90_0643) | - | 607469..607630 (+) | 162 | WP_002987333.1 | hypothetical protein | - |
| FE90_RS03250 (FE90_0644) | - | 607633..608244 (+) | 612 | WP_038433337.1 | DUF1366 domain-containing protein | - |
| FE90_RS03255 (FE90_0645) | - | 608260..608535 (+) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| FE90_RS03260 (FE90_0646) | - | 608532..608759 (+) | 228 | WP_000609113.1 | phage holin | - |
| FE90_RS03265 (FE90_0647) | - | 608885..610213 (+) | 1329 | WP_038433339.1 | GH25 family lysozyme | - |
| FE90_RS03270 (FE90_0648) | - | 610292..610732 (-) | 441 | WP_038433341.1 | hypothetical protein | - |
| FE90_RS03275 (FE90_0649) | sda3 | 611004..611804 (-) | 801 | WP_162472510.1 | streptodornase Sda3 | - |
| FE90_RS03280 (FE90_0650) | prx | 612042..612230 (+) | 189 | WP_032461628.1 | hypothetical protein | Regulator |
| FE90_RS03285 (FE90_0651) | - | 612821..613435 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| FE90_RS03290 (FE90_0652) | - | 613562..614347 (-) | 786 | WP_038433345.1 | hypothetical protein | - |
| FE90_RS03295 (FE90_0653) | - | 614357..615055 (-) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| FE90_RS03300 (FE90_0654) | - | 615055..615426 (-) | 372 | WP_038433347.1 | GntR family transcriptional regulator | - |
| FE90_RS03305 (FE90_0655) | - | 615611..618721 (+) | 3111 | WP_038433348.1 | DNA polymerase III subunit alpha | - |
| FE90_RS03310 (FE90_0656) | pfkA | 618801..619814 (+) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| FE90_RS03315 (FE90_0657) | pyk | 619877..621379 (+) | 1503 | WP_038433350.1 | pyruvate kinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7312.35 Da Isoelectric Point: 4.1813
>NTDB_id=123577 FE90_RS03280 WP_032461628.1 612042..612230(+) (prx) [Streptococcus pyogenes strain M23ND]
MLTYDEFKQAIDNGYITADTVMIVRKNEQIFDYVLPHEKVKNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDNGYITADTVMIVRKNEQIFDYVLPHEKVKNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=123577 FE90_RS03280 WP_032461628.1 612042..612230(+) (prx) [Streptococcus pyogenes strain M23ND]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGAACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACCGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGAACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACCGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
88.71 |
100 |
0.887 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
95.161 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
67.742 |
0.5 |