Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FE90_RS02445 | Genome accession | NZ_CP008695 |
| Coordinates | 450532..450714 (+) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain M23ND | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 407325..450714 | 450532..450714 | within | 0 |
Gene organization within MGE regions
Location: 407325..450714
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FE90_RS02180 (FE90_0414) | - | 407325..407918 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| FE90_RS02185 (FE90_0415) | rfbB | 408162..409202 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| FE90_RS02190 (FE90_0416) | - | 409285..410424 (-) | 1140 | WP_011888953.1 | tyrosine-type recombinase/integrase | - |
| FE90_RS02195 (FE90_0417) | - | 410552..410818 (-) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| FE90_RS02200 (FE90_0418) | - | 410830..411216 (-) | 387 | WP_011888747.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FE90_RS02205 (FE90_0419) | - | 411219..411569 (-) | 351 | WP_011888748.1 | helix-turn-helix domain-containing protein | - |
| FE90_RS02210 (FE90_0420) | - | 411877..412092 (+) | 216 | WP_038433225.1 | hypothetical protein | - |
| FE90_RS02220 (FE90_0421) | - | 412304..413110 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| FE90_RS02225 (FE90_0422) | - | 413252..413491 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| FE90_RS02230 (FE90_0423) | - | 413658..413843 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| FE90_RS02235 (FE90_0424) | - | 413921..414232 (+) | 312 | WP_038433227.1 | hypothetical protein | - |
| FE90_RS09945 (FE90_0425) | - | 414234..414404 (+) | 171 | WP_011888947.1 | hypothetical protein | - |
| FE90_RS02240 (FE90_0426) | - | 414397..414600 (+) | 204 | WP_030127424.1 | hypothetical protein | - |
| FE90_RS02245 (FE90_0427) | - | 414597..414983 (+) | 387 | WP_038433229.1 | hypothetical protein | - |
| FE90_RS02250 (FE90_0429) | - | 415127..415477 (+) | 351 | WP_038433231.1 | hypothetical protein | - |
| FE90_RS02255 (FE90_0430) | - | 415474..415677 (+) | 204 | WP_023611025.1 | hypothetical protein | - |
| FE90_RS02260 (FE90_0431) | - | 415766..416065 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| FE90_RS02265 (FE90_0432) | - | 416065..417222 (+) | 1158 | WP_038433232.1 | DUF2800 domain-containing protein | - |
| FE90_RS02270 (FE90_0433) | - | 417231..417794 (+) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| FE90_RS02275 (FE90_0434) | - | 417837..419759 (+) | 1923 | WP_038433233.1 | DNA polymerase | - |
| FE90_RS02280 (FE90_0435) | - | 419764..422148 (+) | 2385 | WP_038433235.1 | phage/plasmid primase, P4 family | - |
| FE90_RS02285 (FE90_0436) | - | 422534..422809 (+) | 276 | WP_015898615.1 | VRR-NUC domain-containing protein | - |
| FE90_RS02290 (FE90_0437) | - | 422806..424128 (+) | 1323 | WP_038433239.1 | SNF2-related protein | - |
| FE90_RS09950 (FE90_0438) | - | 424129..424299 (+) | 171 | WP_164972002.1 | hypothetical protein | - |
| FE90_RS02295 (FE90_0439) | - | 424292..424564 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| FE90_RS02300 (FE90_0441) | - | 424697..425113 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| FE90_RS02305 (FE90_0442) | - | 425203..425655 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| FE90_RS02310 (FE90_0443) | - | 425645..426922 (+) | 1278 | WP_038433241.1 | PBSX family phage terminase large subunit | - |
| FE90_RS02315 (FE90_0444) | - | 426938..428470 (+) | 1533 | WP_038433243.1 | phage portal protein | - |
| FE90_RS02320 (FE90_0445) | - | 428430..429878 (+) | 1449 | WP_032465703.1 | minor capsid protein | - |
| FE90_RS02325 | - | 429906..430094 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| FE90_RS02330 (FE90_0447) | - | 430099..430365 (+) | 267 | WP_011888934.1 | hypothetical protein | - |
| FE90_RS02335 (FE90_0448) | - | 430533..431102 (+) | 570 | WP_011888933.1 | DUF4355 domain-containing protein | - |
| FE90_RS02340 (FE90_0449) | - | 431115..432002 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| FE90_RS02345 (FE90_0450) | - | 432014..432370 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| FE90_RS02350 (FE90_0451) | - | 432381..432659 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| FE90_RS02355 (FE90_0452) | - | 432656..433000 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FE90_RS02360 (FE90_0453) | - | 433004..433363 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| FE90_RS02365 (FE90_0454) | - | 433375..433974 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| FE90_RS02370 (FE90_0455) | - | 434028..434483 (+) | 456 | WP_023079225.1 | tail assembly chaperone | - |
| FE90_RS02375 (FE90_0456) | - | 434558..434791 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| FE90_RS02380 (FE90_0457) | - | 434806..439188 (+) | 4383 | WP_038433245.1 | tape measure protein | - |
| FE90_RS02385 (FE90_0458) | - | 439200..440042 (+) | 843 | WP_038433247.1 | phage tail family protein | - |
| FE90_RS02390 (FE90_0459) | - | 440052..442034 (+) | 1983 | WP_038433248.1 | phage tail protein | - |
| FE90_RS02395 (FE90_0460) | - | 442034..443143 (+) | 1110 | WP_038433249.1 | hyaluronoglucosaminidase | - |
| FE90_RS02400 | - | 443153..445225 (+) | 2073 | Protein_454 | gp58-like family protein | - |
| FE90_RS02405 (FE90_0463) | - | 445237..445665 (+) | 429 | WP_023079897.1 | DUF1617 family protein | - |
| FE90_RS02410 (FE90_0464) | - | 445668..446279 (+) | 612 | WP_023079933.1 | DUF1366 domain-containing protein | - |
| FE90_RS02415 (FE90_0465) | - | 446297..446569 (+) | 273 | WP_011017397.1 | DUF7365 family protein | - |
| FE90_RS02420 (FE90_0466) | - | 446566..446793 (+) | 228 | WP_003058873.1 | phage holin | - |
| FE90_RS02430 (FE90_0467) | - | 446912..448129 (+) | 1218 | WP_038433251.1 | peptidoglycan amidohydrolase family protein | - |
| FE90_RS02435 (FE90_0468) | - | 448265..449389 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| FE90_RS02440 (FE90_0469) | entC3 | 449637..450419 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| FE90_RS02445 (FE90_0470) | prx | 450532..450714 (+) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=123573 FE90_RS02445 WP_011017964.1 450532..450714(+) (prx) [Streptococcus pyogenes strain M23ND]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=123573 FE90_RS02445 WP_011017964.1 450532..450714(+) (prx) [Streptococcus pyogenes strain M23ND]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |