Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | EP54_RS10355 | Genome accession | NZ_CP007670 |
| Coordinates | 2036088..2036513 (-) | Length | 141 a.a. |
| NCBI ID | WP_047335183.1 | Uniprot ID | A0A2C9TRG5 |
| Organism | Staphylococcus aureus strain M121 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2000279..2044987 | 2036088..2036513 | within | 0 |
Gene organization within MGE regions
Location: 2000279..2044987
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EP54_RS10090 (EP54_09580) | - | 2000279..2000794 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| EP54_RS16240 | - | 2000925..2001086 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| EP54_RS17025 | - | 2001433..2001513 (+) | 81 | WP_100250272.1 | hypothetical protein | - |
| EP54_RS10100 (EP54_09590) | - | 2002157..2003602 (-) | 1446 | WP_001148112.1 | SH3 domain-containing protein | - |
| EP54_RS10105 (EP54_09595) | - | 2003583..2004020 (-) | 438 | WP_000354132.1 | phage holin | - |
| EP54_RS10110 (EP54_09600) | - | 2004076..2004471 (-) | 396 | WP_001604146.1 | hypothetical protein | - |
| EP54_RS10115 (EP54_09605) | - | 2004476..2005714 (-) | 1239 | WP_023487053.1 | BppU family phage baseplate upper protein | - |
| EP54_RS10120 (EP54_09610) | - | 2005727..2007601 (-) | 1875 | WP_047335170.1 | glucosaminidase domain-containing protein | - |
| EP54_RS10125 (EP54_09615) | - | 2007738..2008037 (-) | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| EP54_RS10130 | - | 2008078..2008251 (-) | 174 | WP_015990323.1 | XkdX family protein | - |
| EP54_RS10135 (EP54_09625) | - | 2008261..2008638 (-) | 378 | WP_024928064.1 | DUF2977 domain-containing protein | - |
| EP54_RS10140 (EP54_09630) | - | 2008638..2010461 (-) | 1824 | WP_031925170.1 | phage baseplate upper protein | - |
| EP54_RS10145 (EP54_09635) | - | 2010461..2012359 (-) | 1899 | WP_047335171.1 | hypothetical protein | - |
| EP54_RS10150 (EP54_09640) | - | 2012372..2014258 (-) | 1887 | WP_001604154.1 | SGNH/GDSL hydrolase family protein | - |
| EP54_RS10155 (EP54_09645) | - | 2014269..2015210 (-) | 942 | WP_047335172.1 | phage tail domain-containing protein | - |
| EP54_RS10160 (EP54_09650) | - | 2015225..2018110 (-) | 2886 | WP_047335173.1 | terminase | - |
| EP54_RS10165 (EP54_09655) | - | 2018114..2018398 (-) | 285 | WP_000880587.1 | hypothetical protein | - |
| EP54_RS10170 (EP54_09660) | - | 2018443..2018949 (-) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| EP54_RS10175 (EP54_09665) | - | 2019016..2019573 (-) | 558 | WP_000057582.1 | tail protein | - |
| EP54_RS10180 (EP54_09670) | - | 2019574..2019999 (-) | 426 | WP_000270190.1 | DUF3168 domain-containing protein | - |
| EP54_RS10185 | - | 2020012..2020419 (-) | 408 | WP_001151323.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EP54_RS10190 (EP54_09680) | - | 2020406..2020741 (-) | 336 | WP_000483041.1 | phage head closure protein | - |
| EP54_RS10195 (EP54_09685) | - | 2020753..2021103 (-) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| EP54_RS17140 | - | 2021109..2021252 (-) | 144 | WP_000002931.1 | hypothetical protein | - |
| EP54_RS10200 (EP54_09695) | - | 2021264..2022178 (-) | 915 | WP_000235168.1 | phage major capsid protein | - |
| EP54_RS10205 (EP54_09700) | - | 2022195..2022779 (-) | 585 | WP_001019221.1 | DUF4355 domain-containing protein | - |
| EP54_RS10210 (EP54_09705) | - | 2022875..2023825 (-) | 951 | WP_001604161.1 | phage head morphogenesis protein | - |
| EP54_RS10215 (EP54_09710) | - | 2023794..2025218 (-) | 1425 | WP_000177426.1 | phage portal protein | - |
| EP54_RS10220 (EP54_09715) | - | 2025215..2026438 (-) | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
| EP54_RS10225 (EP54_09720) | - | 2026431..2026925 (-) | 495 | WP_000594079.1 | terminase small subunit | - |
| EP54_RS10235 | - | 2027280..2027681 (-) | 402 | WP_000286968.1 | hypothetical protein | - |
| EP54_RS10240 (EP54_09730) | rinB | 2027682..2027855 (-) | 174 | WP_001619900.1 | transcriptional activator RinB | - |
| EP54_RS10245 (EP54_09735) | - | 2027852..2028241 (-) | 390 | WP_001662395.1 | hypothetical protein | - |
| EP54_RS10250 (EP54_09740) | - | 2028231..2028467 (-) | 237 | WP_000608281.1 | hypothetical protein | - |
| EP54_RS10255 (EP54_09745) | - | 2028460..2028663 (-) | 204 | WP_001072795.1 | hypothetical protein | - |
| EP54_RS10260 (EP54_09750) | - | 2028660..2028854 (-) | 195 | WP_000195798.1 | DUF1381 domain-containing protein | - |
| EP54_RS10265 (EP54_09755) | - | 2028851..2029096 (-) | 246 | WP_000120375.1 | hypothetical protein | - |
| EP54_RS10270 (EP54_09760) | - | 2029133..2029642 (-) | 510 | WP_000185637.1 | dUTP diphosphatase | - |
| EP54_RS16250 | - | 2029635..2029805 (-) | 171 | WP_000714409.1 | hypothetical protein | - |
| EP54_RS10280 (EP54_09770) | - | 2029792..2030046 (-) | 255 | WP_047335174.1 | DUF1024 family protein | - |
| EP54_RS10285 (EP54_09775) | - | 2030039..2030428 (-) | 390 | WP_031899414.1 | hypothetical protein | - |
| EP54_RS10290 (EP54_09780) | - | 2030425..2030772 (-) | 348 | WP_047335175.1 | YopX family protein | - |
| EP54_RS10295 (EP54_09785) | - | 2030769..2031173 (-) | 405 | WP_000695756.1 | hypothetical protein | - |
| EP54_RS10300 (EP54_09790) | - | 2031176..2031382 (-) | 207 | WP_000693989.1 | hypothetical protein | - |
| EP54_RS10305 (EP54_09795) | - | 2031396..2031638 (-) | 243 | WP_047335176.1 | SAV1978 family virulence-associated passenger protein | - |
| EP54_RS10310 (EP54_09800) | - | 2031642..2031989 (-) | 348 | Protein_1951 | SA1788 family PVL leukocidin-associated protein | - |
| EP54_RS10315 (EP54_09805) | - | 2031990..2032175 (-) | 186 | WP_047335177.1 | DUF3113 family protein | - |
| EP54_RS10320 (EP54_09810) | - | 2032180..2032584 (-) | 405 | WP_015973976.1 | DUF1064 domain-containing protein | - |
| EP54_RS10325 (EP54_09815) | - | 2032595..2032816 (-) | 222 | WP_047335178.1 | DUF3269 family protein | - |
| EP54_RS10330 (EP54_09820) | - | 2032819..2033034 (-) | 216 | WP_021285875.1 | hypothetical protein | - |
| EP54_RS10335 (EP54_09825) | - | 2033031..2034272 (-) | 1242 | WP_047335179.1 | DnaB helicase C-terminal domain-containing protein | - |
| EP54_RS10340 (EP54_09830) | - | 2034269..2034625 (-) | 357 | WP_047335180.1 | hypothetical protein | - |
| EP54_RS10345 (EP54_09835) | - | 2034625..2035407 (-) | 783 | WP_047335181.1 | phage replisome organizer N-terminal domain-containing protein | - |
| EP54_RS10350 (EP54_09840) | - | 2035379..2036074 (-) | 696 | WP_047335182.1 | putative HNHc nuclease | - |
| EP54_RS10355 (EP54_09845) | ssbA | 2036088..2036513 (-) | 426 | WP_047335183.1 | single-stranded DNA-binding protein | Machinery gene |
| EP54_RS10360 (EP54_09850) | - | 2036513..2037136 (-) | 624 | WP_047335184.1 | DUF1071 domain-containing protein | - |
| EP54_RS10365 (EP54_09855) | - | 2037137..2037673 (-) | 537 | WP_047335185.1 | host-nuclease inhibitor Gam family protein | - |
| EP54_RS10370 (EP54_09860) | - | 2037666..2037902 (-) | 237 | WP_047335186.1 | hypothetical protein | - |
| EP54_RS10375 (EP54_09865) | - | 2037910..2038170 (-) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| EP54_RS10380 (EP54_09870) | - | 2038264..2038584 (-) | 321 | WP_000219666.1 | hypothetical protein | - |
| EP54_RS16255 | - | 2038585..2038752 (-) | 168 | WP_047335187.1 | DUF1270 domain-containing protein | - |
| EP54_RS10390 (EP54_09880) | - | 2038745..2038960 (-) | 216 | WP_025175692.1 | hypothetical protein | - |
| EP54_RS10395 | - | 2039031..2039696 (+) | 666 | WP_031764600.1 | hypothetical protein | - |
| EP54_RS17220 | - | 2039717..2039785 (-) | 69 | Protein_1969 | hypothetical protein | - |
| EP54_RS10400 (EP54_09895) | - | 2039801..2040550 (-) | 750 | WP_001148587.1 | phage antirepressor KilAC domain-containing protein | - |
| EP54_RS10405 (EP54_09900) | - | 2040552..2040737 (-) | 186 | WP_000933365.1 | helix-turn-helix domain-containing protein | - |
| EP54_RS17280 | - | 2041180..2041314 (+) | 135 | WP_001119050.1 | hypothetical protein | - |
| EP54_RS10410 (EP54_09910) | - | 2041311..2041514 (-) | 204 | WP_031764597.1 | hypothetical protein | - |
| EP54_RS10415 (EP54_09915) | - | 2041528..2041764 (-) | 237 | WP_001121116.1 | helix-turn-helix domain-containing protein | - |
| EP54_RS10420 (EP54_09920) | - | 2041915..2042229 (+) | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | - |
| EP54_RS10425 (EP54_09925) | - | 2042242..2042703 (+) | 462 | WP_001573840.1 | phage protein | - |
| EP54_RS10435 (EP54_09935) | - | 2042887..2043408 (+) | 522 | WP_001102444.1 | hypothetical protein | - |
| EP54_RS10440 (EP54_09940) | - | 2043401..2043871 (+) | 471 | WP_000183249.1 | hypothetical protein | - |
| EP54_RS10445 (EP54_09945) | - | 2043941..2044987 (+) | 1047 | WP_001145732.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15876.39 Da Isoelectric Point: 5.1746
>NTDB_id=122318 EP54_RS10355 WP_047335183.1 2036088..2036513(-) (ssbA) [Staphylococcus aureus strain M121]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINCVTFRKQADNVNNYLSKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCDSVQFLEPKNNNQQPNNNYHQQGQTQTGNNPFDNTETDFSDLPF
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINCVTFRKQADNVNNYLSKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCDSVQFLEPKNNNQQPNNNYHQQGQTQTGNNPFDNTETDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=122318 EP54_RS10355 WP_047335183.1 2036088..2036513(-) (ssbA) [Staphylococcus aureus strain M121]
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGCGTAAATGTAGG
GACGTTCACATTAGCAGTAAACAGAACATTCACAAACGCGCAAGGAGAACGTGAGGCAGATTTTATTAATTGTGTAACTT
TTAGAAAACAAGCAGATAACGTGAATAACTATTTATCAAAAGGATCATTAGCTGGTGTTGACGGACGCCTACAATCACGT
AGTTATGAAAATCAAGAAGGTCGTCGTGTATTTGTTACCGAAGTTGTATGTGACAGTGTCCAATTCCTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAGGACAAACTCAAACTGGTAATAATCCATTTGACAATACTGAAA
CAGATTTTTCAGACCTCCCATTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGCGTAAATGTAGG
GACGTTCACATTAGCAGTAAACAGAACATTCACAAACGCGCAAGGAGAACGTGAGGCAGATTTTATTAATTGTGTAACTT
TTAGAAAACAAGCAGATAACGTGAATAACTATTTATCAAAAGGATCATTAGCTGGTGTTGACGGACGCCTACAATCACGT
AGTTATGAAAATCAAGAAGGTCGTCGTGTATTTGTTACCGAAGTTGTATGTGACAGTGTCCAATTCCTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAGGACAAACTCAAACTGGTAATAATCCATTTGACAATACTGAAA
CAGATTTTTCAGACCTCCCATTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
75.424 |
83.688 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.605 |
100 |
0.589 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
75.177 |
0.454 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.298 |
100 |
0.383 |
| ssbA | Streptococcus mutans UA159 |
44.348 |
81.56 |
0.362 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.22 |
83.688 |
0.362 |