Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DK93_RS03800 | Genome accession | NZ_CP007562 |
| Coordinates | 761193..761414 (+) | Length | 73 a.a. |
| NCBI ID | WP_011184577.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NGAS327 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 728290..768970 | 761193..761414 | within | 0 |
Gene organization within MGE regions
Location: 728290..768970
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DK93_RS03585 (DK93_03705) | - | 728290..728910 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DK93_RS03590 (DK93_03710) | - | 729273..730361 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| DK93_RS03595 (DK93_03715) | - | 730482..731375 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| DK93_RS03600 (DK93_03720) | - | 731411..732235 (-) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| DK93_RS08390 | - | 732592..732750 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| DK93_RS03605 (DK93_03735) | - | 732780..733379 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DK93_RS03610 (DK93_03740) | - | 733433..733642 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DK93_RS03615 (DK93_03745) | - | 733631..734017 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DK93_RS03620 (DK93_03750) | - | 734091..734291 (+) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| DK93_RS03625 (DK93_03755) | - | 734401..734610 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| DK93_RS03630 (DK93_03760) | - | 734741..735250 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DK93_RS03640 (DK93_03770) | - | 735509..735718 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DK93_RS03645 (DK93_03780) | - | 735894..736112 (-) | 219 | WP_023079659.1 | hypothetical protein | - |
| DK93_RS03650 (DK93_03785) | - | 736255..736431 (+) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| DK93_RS03655 (DK93_03790) | - | 736509..736805 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DK93_RS08395 | - | 736802..736939 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| DK93_RS03660 (DK93_03805) | - | 737020..737349 (+) | 330 | WP_002984312.1 | hypothetical protein | - |
| DK93_RS03665 (DK93_03810) | - | 737349..737543 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DK93_RS03670 (DK93_03815) | - | 737540..737824 (+) | 285 | WP_002984318.1 | hypothetical protein | - |
| DK93_RS03675 | - | 737821..738504 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DK93_RS03680 (DK93_03825) | - | 738510..739943 (+) | 1434 | Protein_674 | DEAD/DEAH box helicase | - |
| DK93_RS03685 (DK93_03830) | - | 739948..740430 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DK93_RS03690 (DK93_03835) | - | 740448..742001 (+) | 1554 | WP_002984332.1 | hypothetical protein | - |
| DK93_RS03695 (DK93_03840) | - | 742279..743148 (+) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| DK93_RS03700 (DK93_03845) | - | 743168..743452 (+) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| DK93_RS03705 (DK93_03850) | - | 743436..743795 (+) | 360 | WP_047236124.1 | hypothetical protein | - |
| DK93_RS03715 (DK93_03860) | - | 744148..744501 (+) | 354 | WP_032462877.1 | tail assembly chaperone | - |
| DK93_RS03720 (DK93_03865) | - | 744543..744872 (+) | 330 | WP_002988428.1 | hypothetical protein | - |
| DK93_RS03725 (DK93_03870) | - | 744887..748522 (+) | 3636 | WP_032462878.1 | tape measure protein | - |
| DK93_RS03730 (DK93_03875) | - | 748554..749333 (+) | 780 | WP_032462880.1 | distal tail protein Dit | - |
| DK93_RS03735 (DK93_03880) | - | 749330..751381 (+) | 2052 | WP_032462881.1 | phage tail spike protein | - |
| DK93_RS03740 (DK93_03885) | - | 751378..752382 (+) | 1005 | WP_047236125.1 | hyaluronoglucosaminidase | - |
| DK93_RS03745 (DK93_03890) | - | 752397..754283 (+) | 1887 | WP_032462883.1 | gp58-like family protein | - |
| DK93_RS03750 (DK93_03895) | - | 754295..754723 (+) | 429 | WP_011184582.1 | DUF1617 family protein | - |
| DK93_RS03755 (DK93_03900) | - | 754726..755331 (+) | 606 | WP_011184581.1 | DUF1366 domain-containing protein | - |
| DK93_RS03760 (DK93_03905) | - | 755347..755802 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| DK93_RS08895 (DK93_03910) | - | 755804..755926 (+) | 123 | WP_027968869.1 | hypothetical protein | - |
| DK93_RS03770 (DK93_03915) | - | 755914..756468 (+) | 555 | Protein_691 | glycoside hydrolase family 73 protein | - |
| DK93_RS03775 (DK93_03920) | - | 756704..757396 (+) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| DK93_RS03780 (DK93_03930) | - | 757509..758150 (+) | 642 | Protein_693 | CHAP domain-containing protein | - |
| DK93_RS03785 (DK93_03940) | spek | 759017..759796 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DK93_RS03790 (DK93_03945) | - | 760272..760847 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| DK93_RS03800 (DK93_03955) | prx | 761193..761414 (+) | 222 | WP_011184577.1 | hypothetical protein | Regulator |
| DK93_RS03805 (DK93_03960) | - | 761973..762587 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DK93_RS03810 (DK93_03965) | - | 762718..763503 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
| DK93_RS03815 (DK93_03970) | - | 763513..764211 (-) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
| DK93_RS03820 (DK93_03975) | - | 764211..764582 (-) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DK93_RS03825 (DK93_03980) | - | 764767..767877 (+) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| DK93_RS03830 (DK93_03985) | pfkA | 767957..768970 (+) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 73 a.a. Molecular weight: 8688.99 Da Isoelectric Point: 4.3322
>NTDB_id=120945 DK93_RS03800 WP_011184577.1 761193..761414(+) (prx) [Streptococcus pyogenes strain NGAS327]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTEEKVEEVMVELDYIIMKKTLSRQKNN
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTEEKVEEVMVELDYIIMKKTLSRQKNN
Nucleotide
Download Length: 222 bp
>NTDB_id=120945 DK93_RS03800 WP_011184577.1 761193..761414(+) (prx) [Streptococcus pyogenes strain NGAS327]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCATAATGAAGAAAACTTTGAGTAGACAGAAAAATAATTGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCATAATGAAGAAAACTTTGAGTAGACAGAAAAATAATTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.803 |
83.562 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
84.483 |
79.452 |
0.671 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
80.822 |
0.658 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
79.452 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
80.822 |
0.616 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
56.164 |
0.507 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
57.534 |
0.452 |