Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DI45_RS03125 | Genome accession | NZ_CP007560 |
| Coordinates | 584923..585105 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain NGAS743 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545739..585105 | 584923..585105 | within | 0 |
Gene organization within MGE regions
Location: 545739..585105
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DI45_RS02845 (DI45_02950) | - | 545739..546716 (+) | 978 | WP_011284642.1 | YvcK family protein | - |
| DI45_RS02850 (DI45_02955) | whiA | 546713..547624 (+) | 912 | WP_047235220.1 | DNA-binding protein WhiA | - |
| DI45_RS02855 (DI45_02960) | - | 547801..549216 (-) | 1416 | WP_011017563.1 | recombinase family protein | - |
| DI45_RS02860 (DI45_02965) | - | 549339..549644 (-) | 306 | WP_002985420.1 | membrane protein | - |
| DI45_RS02865 (DI45_02970) | - | 549654..550418 (-) | 765 | WP_002985417.1 | XRE family transcriptional regulator | - |
| DI45_RS09830 | - | 550778..550936 (+) | 159 | WP_002985414.1 | hypothetical protein | - |
| DI45_RS02870 (DI45_02980) | - | 551035..551676 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| DI45_RS02875 (DI45_02985) | - | 551728..551916 (+) | 189 | WP_002985407.1 | helix-turn-helix transcriptional regulator | - |
| DI45_RS02880 (DI45_02990) | - | 551965..552726 (+) | 762 | WP_002985404.1 | phage repressor protein/antirepressor Ant | - |
| DI45_RS10590 | - | 552739..552870 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| DI45_RS02885 (DI45_03000) | - | 552867..553049 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| DI45_RS09835 | - | 553136..553273 (+) | 138 | WP_002985395.1 | BOW99_gp33 family protein | - |
| DI45_RS02890 (DI45_03010) | - | 553275..553460 (+) | 186 | WP_002985392.1 | hypothetical protein | - |
| DI45_RS10450 | - | 553560..553799 (+) | 240 | WP_002985390.1 | hypothetical protein | - |
| DI45_RS02900 (DI45_03015) | - | 553958..554344 (+) | 387 | WP_002985388.1 | DnaD domain-containing protein | - |
| DI45_RS02905 (DI45_03020) | - | 554325..554558 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| DI45_RS10225 | - | 554555..554695 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| DI45_RS02910 (DI45_03030) | - | 554704..554910 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| DI45_RS02915 (DI45_03035) | - | 554966..555298 (+) | 333 | WP_010922475.1 | hypothetical protein | - |
| DI45_RS02920 (DI45_03040) | - | 555298..556287 (+) | 990 | WP_010922474.1 | recombinase RecT | - |
| DI45_RS02925 (DI45_03045) | - | 556284..556484 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DI45_RS02930 (DI45_03050) | - | 556477..557274 (+) | 798 | WP_047235221.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DI45_RS02935 (DI45_03060) | - | 557639..558034 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DI45_RS02940 (DI45_03065) | - | 558031..559377 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| DI45_RS02945 (DI45_03070) | - | 559388..559720 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| DI45_RS02950 (DI45_03075) | - | 559717..560229 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| DI45_RS02955 (DI45_03080) | - | 560265..560582 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DI45_RS10290 | - | 560579..560734 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| DI45_RS02960 (DI45_03090) | - | 560731..560982 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| DI45_RS02965 (DI45_03095) | - | 561058..561477 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| DI45_RS02970 (DI45_03100) | - | 561585..561929 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DI45_RS02975 (DI45_03105) | - | 562077..562433 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DI45_RS02980 (DI45_03110) | - | 562430..563698 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| DI45_RS02985 (DI45_03115) | - | 563691..565184 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DI45_RS02990 (DI45_03120) | - | 565190..565414 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DI45_RS02995 (DI45_03125) | - | 565466..565732 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DI45_RS03000 (DI45_03130) | - | 565734..565970 (+) | 237 | Protein_549 | hypothetical protein | - |
| DI45_RS03005 (DI45_03135) | - | 566052..567467 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| DI45_RS03010 (DI45_03140) | - | 567547..568008 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| DI45_RS03015 (DI45_03145) | - | 568033..568944 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| DI45_RS03020 (DI45_03150) | - | 568944..569144 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DI45_RS03025 (DI45_03155) | - | 569154..569576 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DI45_RS03030 (DI45_03160) | - | 569536..569874 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DI45_RS03035 (DI45_03165) | - | 569867..570103 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| DI45_RS03040 (DI45_03170) | - | 570104..570439 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| DI45_RS03045 (DI45_03175) | - | 570451..571029 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| DI45_RS03050 (DI45_03180) | - | 571040..571303 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| DI45_RS03055 (DI45_03185) | - | 571318..571689 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| DI45_RS03060 (DI45_03190) | - | 571689..574046 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| DI45_RS03065 (DI45_03195) | - | 574043..574738 (+) | 696 | WP_047235222.1 | hypothetical protein | - |
| DI45_RS03070 (DI45_03200) | - | 574720..576696 (+) | 1977 | WP_047235223.1 | phage tail spike protein | - |
| DI45_RS03075 (DI45_03205) | hylP | 576693..577808 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| DI45_RS03080 (DI45_03210) | - | 577823..579604 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| DI45_RS03085 (DI45_03215) | - | 579613..580041 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| DI45_RS03090 (DI45_03220) | - | 580044..580676 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| DI45_RS03095 (DI45_03225) | - | 580688..580960 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DI45_RS03100 (DI45_03230) | - | 580957..581184 (+) | 228 | WP_003058873.1 | phage holin | - |
| DI45_RS03110 (DI45_03240) | - | 581303..582520 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| DI45_RS03115 (DI45_03245) | - | 582656..583780 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| DI45_RS03120 (DI45_03250) | entC3 | 584028..584810 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| DI45_RS03125 (DI45_03255) | prx | 584923..585105 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=120838 DI45_RS03125 WP_011528776.1 584923..585105(+) (prx) [Streptococcus pyogenes strain NGAS743]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=120838 DI45_RS03125 WP_011528776.1 584923..585105(+) (prx) [Streptococcus pyogenes strain NGAS743]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |