Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPAP1_RS03630 | Genome accession | NZ_CP007537 |
| Coordinates | 692574..692756 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714291.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain AP1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 657812..692756 | 692574..692756 | within | 0 |
Gene organization within MGE regions
Location: 657812..692756
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPAP1_RS03370 (SPAP1_03355) | - | 657830..658672 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| SPAP1_RS03375 (SPAP1_03360) | - | 658650..659237 (+) | 588 | WP_010922482.1 | YpmS family protein | - |
| SPAP1_RS03380 (SPAP1_03365) | - | 659336..659611 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPAP1_RS03385 (SPAP1_03370) | - | 659700..660842 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| SPAP1_RS03390 (SPAP1_03375) | - | 660966..661484 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPAP1_RS03395 (SPAP1_03380) | - | 661496..662251 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| SPAP1_RS03400 (SPAP1_03385) | - | 662452..662664 (+) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| SPAP1_RS03405 (SPAP1_03390) | - | 662934..663245 (+) | 312 | WP_010922478.1 | excisionase | - |
| SPAP1_RS03410 (SPAP1_03395) | - | 663247..663432 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPAP1_RS10440 (SPAP1_03400) | - | 663526..663795 (+) | 270 | WP_011106700.1 | replication protein | - |
| SPAP1_RS03420 (SPAP1_03405) | - | 663936..664322 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| SPAP1_RS03425 (SPAP1_03410) | - | 664303..664536 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| SPAP1_RS10190 | - | 664533..664673 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| SPAP1_RS03430 (SPAP1_03415) | - | 664682..664888 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| SPAP1_RS03435 (SPAP1_03420) | - | 664944..665273 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| SPAP1_RS03440 (SPAP1_03425) | - | 665276..666205 (+) | 930 | WP_011285626.1 | recombinase RecT | - |
| SPAP1_RS03445 (SPAP1_03430) | - | 666202..666999 (+) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPAP1_RS10305 | - | 667009..667176 (+) | 168 | WP_011285624.1 | hypothetical protein | - |
| SPAP1_RS03450 (SPAP1_03435) | - | 667354..667695 (+) | 342 | WP_020837403.1 | hypothetical protein | - |
| SPAP1_RS03455 (SPAP1_03440) | - | 667692..668204 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| SPAP1_RS03460 (SPAP1_03445) | - | 668288..668557 (+) | 270 | WP_002988369.1 | hypothetical protein | - |
| SPAP1_RS03465 (SPAP1_03450) | - | 668559..669194 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| SPAP1_RS03470 (SPAP1_03455) | - | 669462..669881 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| SPAP1_RS03475 (SPAP1_03460) | - | 669990..670334 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| SPAP1_RS03480 (SPAP1_03465) | - | 670483..670839 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPAP1_RS03485 (SPAP1_03470) | - | 670836..672104 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| SPAP1_RS03490 (SPAP1_03475) | - | 672097..673590 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SPAP1_RS03495 (SPAP1_03480) | - | 673596..673820 (+) | 225 | WP_010922466.1 | hypothetical protein | - |
| SPAP1_RS03500 (SPAP1_03485) | - | 673870..674049 (+) | 180 | WP_015055972.1 | hypothetical protein | - |
| SPAP1_RS03505 (SPAP1_03490) | - | 674042..674308 (+) | 267 | WP_010922464.1 | hypothetical protein | - |
| SPAP1_RS03510 (SPAP1_03495) | - | 674418..675833 (+) | 1416 | WP_011285619.1 | terminase | - |
| SPAP1_RS03515 (SPAP1_03500) | - | 675914..676375 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| SPAP1_RS03520 (SPAP1_03505) | - | 676400..677311 (+) | 912 | WP_010922461.1 | phage major capsid protein | - |
| SPAP1_RS03525 (SPAP1_03510) | - | 677311..677511 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPAP1_RS03530 (SPAP1_03515) | - | 677521..677943 (+) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPAP1_RS03535 (SPAP1_03520) | - | 677903..678241 (+) | 339 | WP_011285617.1 | hypothetical protein | - |
| SPAP1_RS03540 (SPAP1_03525) | - | 678234..678470 (+) | 237 | WP_010922457.1 | hypothetical protein | - |
| SPAP1_RS03545 (SPAP1_03530) | - | 678471..678806 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPAP1_RS03550 (SPAP1_03535) | - | 678818..679411 (+) | 594 | WP_010922456.1 | tail protein | - |
| SPAP1_RS03555 (SPAP1_03540) | - | 679422..679685 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPAP1_RS03560 (SPAP1_03545) | - | 679700..680071 (+) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| SPAP1_RS03565 (SPAP1_03550) | - | 680071..682428 (+) | 2358 | WP_010922453.1 | hypothetical protein | - |
| SPAP1_RS03570 (SPAP1_03555) | - | 682425..683120 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| SPAP1_RS03575 (SPAP1_03560) | - | 683117..685075 (+) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| SPAP1_RS03580 (SPAP1_03565) | - | 685075..686076 (+) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| SPAP1_RS03585 (SPAP1_03570) | - | 686091..687875 (+) | 1785 | WP_010922449.1 | gp58-like family protein | - |
| SPAP1_RS03590 (SPAP1_03575) | - | 687887..688318 (+) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| SPAP1_RS03595 (SPAP1_03580) | - | 688321..688938 (+) | 618 | WP_010922447.1 | DUF1366 domain-containing protein | - |
| SPAP1_RS03600 (SPAP1_03585) | - | 688948..689223 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| SPAP1_RS03605 (SPAP1_03590) | - | 689220..689447 (+) | 228 | WP_003058873.1 | phage holin | - |
| SPAP1_RS03615 (SPAP1_03600) | - | 689563..690768 (+) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| SPAP1_RS03620 (SPAP1_03605) | - | 690838..691272 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| SPAP1_RS03625 (SPAP1_03610) | sda3 | 691545..692345 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SPAP1_RS03630 (SPAP1_03615) | prx | 692574..692756 (+) | 183 | WP_029714291.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6974.02 Da Isoelectric Point: 4.7361
>NTDB_id=120625 SPAP1_RS03630 WP_029714291.1 692574..692756(+) (prx) [Streptococcus pyogenes strain AP1]
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=120625 SPAP1_RS03630 WP_029714291.1 692574..692756(+) (prx) [Streptococcus pyogenes strain AP1]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
95 |
100 |
0.95 |
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |