Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPAP1_RS02910 | Genome accession | NZ_CP007537 |
| Coordinates | 555280..555462 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain AP1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 514251..555462 | 555280..555462 | within | 0 |
Gene organization within MGE regions
Location: 514251..555462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPAP1_RS02635 (SPAP1_02620) | - | 514251..515417 (-) | 1167 | WP_011018152.1 | site-specific integrase | - |
| SPAP1_RS02640 (SPAP1_02625) | - | 515599..517020 (-) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| SPAP1_RS02645 (SPAP1_02630) | - | 517035..517421 (-) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPAP1_RS02650 (SPAP1_02635) | - | 517405..517746 (-) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| SPAP1_RS02655 (SPAP1_02640) | - | 517944..518156 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| SPAP1_RS02660 (SPAP1_02645) | - | 518184..518903 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| SPAP1_RS02665 (SPAP1_02650) | - | 519001..519240 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| SPAP1_RS02670 (SPAP1_02655) | - | 519407..519592 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| SPAP1_RS02675 (SPAP1_02660) | - | 519663..519914 (+) | 252 | WP_011888682.1 | hypothetical protein | - |
| SPAP1_RS09840 | - | 519945..520082 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| SPAP1_RS02680 (SPAP1_02665) | - | 520176..520937 (+) | 762 | WP_014635613.1 | DnaD domain protein | - |
| SPAP1_RS02685 (SPAP1_02670) | - | 520924..521706 (+) | 783 | WP_011888684.1 | ATP-binding protein | - |
| SPAP1_RS02690 (SPAP1_02675) | - | 521847..522200 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| SPAP1_RS02695 (SPAP1_02680) | - | 522181..522435 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| SPAP1_RS02700 (SPAP1_02685) | - | 522457..522939 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPAP1_RS02705 (SPAP1_02690) | - | 522940..523614 (+) | 675 | WP_046735269.1 | ERF family protein | - |
| SPAP1_RS02710 (SPAP1_02695) | ssb | 523607..524032 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| SPAP1_RS02715 (SPAP1_02700) | - | 524038..524241 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPAP1_RS02720 (SPAP1_02705) | - | 524241..524681 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPAP1_RS02725 (SPAP1_02710) | - | 524678..525034 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| SPAP1_RS10635 (SPAP1_02715) | - | 525031..525276 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| SPAP1_RS02735 (SPAP1_02720) | - | 525276..525512 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| SPAP1_RS10290 | - | 525509..525679 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| SPAP1_RS02740 (SPAP1_02725) | - | 525676..525960 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| SPAP1_RS02745 (SPAP1_02730) | - | 525962..526594 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| SPAP1_RS02750 (SPAP1_02735) | - | 526599..527078 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| SPAP1_RS10295 | - | 527075..527245 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| SPAP1_RS02755 (SPAP1_02740) | - | 527529..527963 (+) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPAP1_RS02760 (SPAP1_02745) | - | 528597..529763 (+) | 1167 | Protein_496 | DNA modification methylase | - |
| SPAP1_RS02765 (SPAP1_02750) | - | 530106..530582 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| SPAP1_RS02770 (SPAP1_02755) | - | 530585..531876 (+) | 1292 | Protein_498 | PBSX family phage terminase large subunit | - |
| SPAP1_RS02775 (SPAP1_02760) | - | 531890..533392 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| SPAP1_RS02780 (SPAP1_02765) | - | 533397..534890 (+) | 1494 | WP_029714379.1 | phage minor capsid protein | - |
| SPAP1_RS02785 (SPAP1_02770) | - | 534890..535117 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| SPAP1_RS02790 (SPAP1_02775) | - | 535204..535470 (+) | 267 | WP_011888689.1 | hypothetical protein | - |
| SPAP1_RS02795 (SPAP1_02780) | - | 535596..536210 (+) | 615 | WP_011888690.1 | hypothetical protein | - |
| SPAP1_RS02800 (SPAP1_02785) | - | 536214..537032 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPAP1_RS02805 (SPAP1_02790) | - | 537086..537502 (+) | 417 | WP_011888692.1 | hypothetical protein | - |
| SPAP1_RS02810 (SPAP1_02795) | - | 537492..537824 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| SPAP1_RS02815 (SPAP1_02800) | - | 537824..538180 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPAP1_RS02820 (SPAP1_02805) | - | 538177..538575 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| SPAP1_RS02825 (SPAP1_02810) | - | 538575..539036 (+) | 462 | WP_011018120.1 | hypothetical protein | - |
| SPAP1_RS02830 (SPAP1_02815) | - | 539080..539514 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| SPAP1_RS02835 (SPAP1_02820) | - | 539518..540099 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| SPAP1_RS02840 (SPAP1_02825) | - | 540089..543349 (+) | 3261 | WP_029714384.1 | tape measure protein | - |
| SPAP1_RS02845 (SPAP1_02830) | - | 543346..544062 (+) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| SPAP1_RS02850 (SPAP1_02835) | - | 544059..546203 (+) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| SPAP1_RS02855 (SPAP1_02840) | - | 546200..547210 (+) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| SPAP1_RS02860 (SPAP1_02845) | - | 547223..549109 (+) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| SPAP1_RS02865 (SPAP1_02850) | - | 549121..549552 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| SPAP1_RS02870 (SPAP1_02855) | - | 549555..550187 (+) | 633 | WP_011888699.1 | hypothetical protein | - |
| SPAP1_RS02875 (SPAP1_02860) | - | 550197..550652 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| SPAP1_RS10570 (SPAP1_02865) | - | 550654..550776 (+) | 123 | WP_029713948.1 | hypothetical protein | - |
| SPAP1_RS02885 (SPAP1_02870) | - | 550764..551969 (+) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| SPAP1_RS02890 (SPAP1_02875) | - | 552109..552633 (+) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| SPAP1_RS02895 (SPAP1_02880) | - | 552621..553487 (+) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| SPAP1_RS02900 (SPAP1_02885) | - | 553537..553971 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| SPAP1_RS02905 (SPAP1_02890) | sda3 | 554242..555042 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SPAP1_RS02910 (SPAP1_02895) | prx | 555280..555462 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=120622 SPAP1_RS02910 WP_011184907.1 555280..555462(+) (prx) [Streptococcus pyogenes strain AP1]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=120622 SPAP1_RS02910 WP_011184907.1 555280..555462(+) (prx) [Streptococcus pyogenes strain AP1]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |