Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   CH51_RS05825 Genome accession   NZ_CP007499
Coordinates   1161630..1162100 (+) Length   156 a.a.
NCBI ID   WP_000934764.1    Uniprot ID   A0A9P4DKA4
Organism   Staphylococcus aureus strain 2395 USA500     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1147057..1194046 1161630..1162100 within 0


Gene organization within MGE regions


Location: 1147057..1194046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CH51_RS05715 (CH51_05435) - 1147057..1147983 (-) 927 WP_000757569.1 glycerophosphodiester phosphodiesterase -
  CH51_RS05720 (CH51_05440) - 1148222..1148476 (+) 255 WP_001049149.1 YlbG family protein -
  CH51_RS05725 (CH51_05445) - 1148479..1148868 (-) 390 WP_000814565.1 hypothetical protein -
  CH51_RS05730 (CH51_05450) rsmD 1148938..1149480 (+) 543 WP_001263796.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  CH51_RS05735 (CH51_05455) coaD 1149482..1149964 (+) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  CH51_RS05740 (CH51_05460) - 1150026..1151165 (-) 1140 WP_000843611.1 nucleotidyltransferase -
  CH51_RS05745 (CH51_05465) - 1151292..1151849 (+) 558 WP_000872158.1 YceD family protein -
  CH51_RS05755 (CH51_05470) rpmF 1151929..1152102 (+) 174 WP_000290472.1 50S ribosomal protein L32 -
  CH51_RS05760 (CH51_05475) - 1152219..1153604 (-) 1386 WP_000861313.1 recombinase family protein -
  CH51_RS16750 - 1153811..1153933 (-) 123 WP_001077637.1 hypothetical protein -
  CH51_RS05765 (CH51_05485) - 1153954..1154415 (-) 462 WP_000525016.1 hypothetical protein -
  CH51_RS05770 (CH51_05490) - 1154428..1154751 (-) 324 WP_001260487.1 helix-turn-helix domain-containing protein -
  CH51_RS05775 (CH51_05495) - 1154915..1155163 (+) 249 WP_000272858.1 helix-turn-helix domain-containing protein -
  CH51_RS16600 - 1155178..1155339 (+) 162 WP_001153175.1 hypothetical protein -
  CH51_RS05780 (CH51_05505) - 1155332..1155568 (-) 237 WP_000856472.1 hypothetical protein -
  CH51_RS05785 (CH51_05510) - 1155633..1156376 (+) 744 WP_001148623.1 phage antirepressor KilAC domain-containing protein -
  CH51_RS05790 (CH51_05520) - 1156552..1156782 (-) 231 WP_000395455.1 hypothetical protein -
  CH51_RS16695 - 1156832..1156969 (+) 138 WP_000230552.1 hypothetical protein -
  CH51_RS05795 - 1156962..1157123 (+) 162 WP_000066025.1 DUF1270 domain-containing protein -
  CH51_RS05800 (CH51_05535) - 1157218..1157544 (+) 327 WP_000165362.1 DUF2482 family protein -
  CH51_RS05805 (CH51_05540) - 1157525..1157785 (+) 261 WP_000291503.1 DUF1108 family protein -
  CH51_RS15865 - 1157794..1158057 (+) 264 WP_001205732.1 hypothetical protein -
  CH51_RS05810 (CH51_05545) - 1158066..1160009 (+) 1944 WP_000700572.1 AAA family ATPase -
  CH51_RS05815 (CH51_05550) - 1160011..1160931 (+) 921 WP_000138472.1 recombinase RecT -
  CH51_RS05820 (CH51_05555) - 1161012..1161629 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  CH51_RS05825 (CH51_05560) ssbA 1161630..1162100 (+) 471 WP_000934764.1 single-stranded DNA-binding protein Machinery gene
  CH51_RS05830 (CH51_05565) - 1162130..1163014 (+) 885 WP_000148317.1 DnaD domain protein -
  CH51_RS05835 (CH51_05570) - 1163021..1163239 (+) 219 WP_000338530.1 hypothetical protein -
  CH51_RS05840 (CH51_05575) - 1163248..1163652 (+) 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
  CH51_RS05845 (CH51_05580) - 1163665..1164033 (+) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  CH51_RS05850 (CH51_05585) - 1164037..1164279 (+) 243 WP_000131363.1 SAV1978 family virulence-associated passenger protein -
  CH51_RS05855 (CH51_05590) - 1164294..1164500 (+) 207 WP_000693989.1 hypothetical protein -
  CH51_RS05860 (CH51_05595) - 1164503..1164904 (+) 402 WP_000695757.1 hypothetical protein -
  CH51_RS05865 (CH51_05600) - 1164901..1165248 (+) 348 WP_000979209.1 YopX family protein -
  CH51_RS05870 (CH51_05605) - 1165245..1165553 (+) 309 WP_000144711.1 hypothetical protein -
  CH51_RS05875 (CH51_05610) - 1165546..1165781 (+) 236 Protein_1134 DUF1024 family protein -
  CH51_RS05880 (CH51_05615) - 1165786..1166295 (+) 510 WP_000185636.1 dUTP diphosphatase -
  CH51_RS05885 (CH51_05620) - 1166332..1166568 (+) 237 WP_000195816.1 DUF1381 domain-containing protein -
  CH51_RS05890 (CH51_05625) - 1166593..1166829 (+) 237 WP_000483478.1 hypothetical protein -
  CH51_RS05895 (CH51_05630) rinB 1166822..1166995 (+) 174 WP_000591892.1 transcriptional activator RinB -
  CH51_RS05900 (CH51_05635) - 1166996..1167361 (+) 366 WP_000989954.1 hypothetical protein -
  CH51_RS05905 - 1167362..1167508 (+) 147 WP_000989960.1 hypothetical protein -
  CH51_RS05910 (CH51_05645) - 1167532..1167954 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  CH51_RS05915 (CH51_05650) - 1168141..1168581 (+) 441 WP_001003271.1 terminase small subunit -
  CH51_RS05920 (CH51_05655) - 1168568..1169845 (+) 1278 WP_000169946.1 PBSX family phage terminase large subunit -
  CH51_RS05925 (CH51_05660) - 1169856..1171394 (+) 1539 WP_000909977.1 phage portal protein -
  CH51_RS05930 (CH51_05665) - 1171401..1172396 (+) 996 WP_001133044.1 minor capsid protein -
  CH51_RS05935 - 1172469..1172639 (+) 171 WP_000072208.1 hypothetical protein -
  CH51_RS16700 - 1172667..1172754 (+) 88 Protein_1147 hypothetical protein -
  CH51_RS05940 (CH51_05680) - 1172748..1173368 (+) 621 WP_000392148.1 DUF4355 domain-containing protein -
  CH51_RS05945 (CH51_05685) - 1173382..1174356 (+) 975 WP_000438504.1 phage major capsid protein -
  CH51_RS05950 (CH51_05690) - 1174378..1174665 (+) 288 WP_001114085.1 hypothetical protein -
  CH51_RS05955 (CH51_05695) - 1174674..1175006 (+) 333 WP_000208960.1 phage head-tail connector protein -
  CH51_RS05960 (CH51_05700) - 1175003..1175305 (+) 303 WP_001268312.1 hypothetical protein -
  CH51_RS05965 (CH51_05705) - 1175305..1175652 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  CH51_RS05970 (CH51_05710) - 1175664..1176047 (+) 384 WP_000188648.1 hypothetical protein -
  CH51_RS05975 (CH51_05715) - 1176066..1176647 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  CH51_RS05980 (CH51_05720) - 1176709..1177074 (+) 366 WP_001100162.1 tail assembly chaperone -
  CH51_RS05985 (CH51_05725) - 1177104..1177448 (+) 345 WP_000105584.1 hypothetical protein -
  CH51_RS05990 - 1177465..1180929 (+) 3465 WP_000141452.1 hypothetical protein -
  CH51_RS05995 (CH51_05755) - 1180942..1181889 (+) 948 WP_000350680.1 phage tail family protein -
  CH51_RS06000 (CH51_05760) - 1181898..1183799 (+) 1902 WP_000156407.1 SGNH/GDSL hydrolase family protein -
  CH51_RS06005 (CH51_05765) - 1183814..1185724 (+) 1911 WP_000369024.1 hypothetical protein -
  CH51_RS06010 (CH51_05770) - 1185724..1187547 (+) 1824 WP_000259631.1 phage baseplate upper protein -
  CH51_RS06015 (CH51_05775) - 1187547..1187924 (+) 378 WP_000705893.1 DUF2977 domain-containing protein -
  CH51_RS06020 - 1187928..1188101 (+) 174 WP_001790193.1 XkdX family protein -
  CH51_RS06025 (CH51_05785) - 1188142..1188441 (+) 300 WP_000466770.1 DUF2951 domain-containing protein -
  CH51_RS06030 (CH51_05790) - 1188578..1190476 (+) 1899 WP_000524017.1 glucosaminidase domain-containing protein -
  CH51_RS06035 (CH51_05795) - 1190489..1191727 (+) 1239 WP_000276641.1 BppU family phage baseplate upper protein -
  CH51_RS06040 (CH51_05800) - 1191732..1192127 (+) 396 WP_000398862.1 hypothetical protein -
  CH51_RS06045 (CH51_05805) - 1192183..1192620 (+) 438 WP_000354121.1 phage holin -
  CH51_RS06050 (CH51_05810) - 1192601..1194046 (+) 1446 WP_001148123.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17627.49 Da        Isoelectric Point: 5.2672

>NTDB_id=120002 CH51_RS05825 WP_000934764.1 1161630..1162100(+) (ssbA) [Staphylococcus aureus strain 2395 USA500]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=120002 CH51_RS05825 WP_000934764.1 1161630..1162100(+) (ssbA) [Staphylococcus aureus strain 2395 USA500]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372

  ssb Vibrio cholerae strain A1552

31.492

100

0.365


Multiple sequence alignment