Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CH51_RS05825 | Genome accession | NZ_CP007499 |
| Coordinates | 1161630..1162100 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain 2395 USA500 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1147057..1194046 | 1161630..1162100 | within | 0 |
Gene organization within MGE regions
Location: 1147057..1194046
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CH51_RS05715 (CH51_05435) | - | 1147057..1147983 (-) | 927 | WP_000757569.1 | glycerophosphodiester phosphodiesterase | - |
| CH51_RS05720 (CH51_05440) | - | 1148222..1148476 (+) | 255 | WP_001049149.1 | YlbG family protein | - |
| CH51_RS05725 (CH51_05445) | - | 1148479..1148868 (-) | 390 | WP_000814565.1 | hypothetical protein | - |
| CH51_RS05730 (CH51_05450) | rsmD | 1148938..1149480 (+) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| CH51_RS05735 (CH51_05455) | coaD | 1149482..1149964 (+) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| CH51_RS05740 (CH51_05460) | - | 1150026..1151165 (-) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| CH51_RS05745 (CH51_05465) | - | 1151292..1151849 (+) | 558 | WP_000872158.1 | YceD family protein | - |
| CH51_RS05755 (CH51_05470) | rpmF | 1151929..1152102 (+) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| CH51_RS05760 (CH51_05475) | - | 1152219..1153604 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| CH51_RS16750 | - | 1153811..1153933 (-) | 123 | WP_001077637.1 | hypothetical protein | - |
| CH51_RS05765 (CH51_05485) | - | 1153954..1154415 (-) | 462 | WP_000525016.1 | hypothetical protein | - |
| CH51_RS05770 (CH51_05490) | - | 1154428..1154751 (-) | 324 | WP_001260487.1 | helix-turn-helix domain-containing protein | - |
| CH51_RS05775 (CH51_05495) | - | 1154915..1155163 (+) | 249 | WP_000272858.1 | helix-turn-helix domain-containing protein | - |
| CH51_RS16600 | - | 1155178..1155339 (+) | 162 | WP_001153175.1 | hypothetical protein | - |
| CH51_RS05780 (CH51_05505) | - | 1155332..1155568 (-) | 237 | WP_000856472.1 | hypothetical protein | - |
| CH51_RS05785 (CH51_05510) | - | 1155633..1156376 (+) | 744 | WP_001148623.1 | phage antirepressor KilAC domain-containing protein | - |
| CH51_RS05790 (CH51_05520) | - | 1156552..1156782 (-) | 231 | WP_000395455.1 | hypothetical protein | - |
| CH51_RS16695 | - | 1156832..1156969 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| CH51_RS05795 | - | 1156962..1157123 (+) | 162 | WP_000066025.1 | DUF1270 domain-containing protein | - |
| CH51_RS05800 (CH51_05535) | - | 1157218..1157544 (+) | 327 | WP_000165362.1 | DUF2482 family protein | - |
| CH51_RS05805 (CH51_05540) | - | 1157525..1157785 (+) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| CH51_RS15865 | - | 1157794..1158057 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| CH51_RS05810 (CH51_05545) | - | 1158066..1160009 (+) | 1944 | WP_000700572.1 | AAA family ATPase | - |
| CH51_RS05815 (CH51_05550) | - | 1160011..1160931 (+) | 921 | WP_000138472.1 | recombinase RecT | - |
| CH51_RS05820 (CH51_05555) | - | 1161012..1161629 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| CH51_RS05825 (CH51_05560) | ssbA | 1161630..1162100 (+) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| CH51_RS05830 (CH51_05565) | - | 1162130..1163014 (+) | 885 | WP_000148317.1 | DnaD domain protein | - |
| CH51_RS05835 (CH51_05570) | - | 1163021..1163239 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| CH51_RS05840 (CH51_05575) | - | 1163248..1163652 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CH51_RS05845 (CH51_05580) | - | 1163665..1164033 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| CH51_RS05850 (CH51_05585) | - | 1164037..1164279 (+) | 243 | WP_000131363.1 | SAV1978 family virulence-associated passenger protein | - |
| CH51_RS05855 (CH51_05590) | - | 1164294..1164500 (+) | 207 | WP_000693989.1 | hypothetical protein | - |
| CH51_RS05860 (CH51_05595) | - | 1164503..1164904 (+) | 402 | WP_000695757.1 | hypothetical protein | - |
| CH51_RS05865 (CH51_05600) | - | 1164901..1165248 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| CH51_RS05870 (CH51_05605) | - | 1165245..1165553 (+) | 309 | WP_000144711.1 | hypothetical protein | - |
| CH51_RS05875 (CH51_05610) | - | 1165546..1165781 (+) | 236 | Protein_1134 | DUF1024 family protein | - |
| CH51_RS05880 (CH51_05615) | - | 1165786..1166295 (+) | 510 | WP_000185636.1 | dUTP diphosphatase | - |
| CH51_RS05885 (CH51_05620) | - | 1166332..1166568 (+) | 237 | WP_000195816.1 | DUF1381 domain-containing protein | - |
| CH51_RS05890 (CH51_05625) | - | 1166593..1166829 (+) | 237 | WP_000483478.1 | hypothetical protein | - |
| CH51_RS05895 (CH51_05630) | rinB | 1166822..1166995 (+) | 174 | WP_000591892.1 | transcriptional activator RinB | - |
| CH51_RS05900 (CH51_05635) | - | 1166996..1167361 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| CH51_RS05905 | - | 1167362..1167508 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| CH51_RS05910 (CH51_05645) | - | 1167532..1167954 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| CH51_RS05915 (CH51_05650) | - | 1168141..1168581 (+) | 441 | WP_001003271.1 | terminase small subunit | - |
| CH51_RS05920 (CH51_05655) | - | 1168568..1169845 (+) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| CH51_RS05925 (CH51_05660) | - | 1169856..1171394 (+) | 1539 | WP_000909977.1 | phage portal protein | - |
| CH51_RS05930 (CH51_05665) | - | 1171401..1172396 (+) | 996 | WP_001133044.1 | minor capsid protein | - |
| CH51_RS05935 | - | 1172469..1172639 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| CH51_RS16700 | - | 1172667..1172754 (+) | 88 | Protein_1147 | hypothetical protein | - |
| CH51_RS05940 (CH51_05680) | - | 1172748..1173368 (+) | 621 | WP_000392148.1 | DUF4355 domain-containing protein | - |
| CH51_RS05945 (CH51_05685) | - | 1173382..1174356 (+) | 975 | WP_000438504.1 | phage major capsid protein | - |
| CH51_RS05950 (CH51_05690) | - | 1174378..1174665 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| CH51_RS05955 (CH51_05695) | - | 1174674..1175006 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| CH51_RS05960 (CH51_05700) | - | 1175003..1175305 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| CH51_RS05965 (CH51_05705) | - | 1175305..1175652 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CH51_RS05970 (CH51_05710) | - | 1175664..1176047 (+) | 384 | WP_000188648.1 | hypothetical protein | - |
| CH51_RS05975 (CH51_05715) | - | 1176066..1176647 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| CH51_RS05980 (CH51_05720) | - | 1176709..1177074 (+) | 366 | WP_001100162.1 | tail assembly chaperone | - |
| CH51_RS05985 (CH51_05725) | - | 1177104..1177448 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| CH51_RS05990 | - | 1177465..1180929 (+) | 3465 | WP_000141452.1 | hypothetical protein | - |
| CH51_RS05995 (CH51_05755) | - | 1180942..1181889 (+) | 948 | WP_000350680.1 | phage tail family protein | - |
| CH51_RS06000 (CH51_05760) | - | 1181898..1183799 (+) | 1902 | WP_000156407.1 | SGNH/GDSL hydrolase family protein | - |
| CH51_RS06005 (CH51_05765) | - | 1183814..1185724 (+) | 1911 | WP_000369024.1 | hypothetical protein | - |
| CH51_RS06010 (CH51_05770) | - | 1185724..1187547 (+) | 1824 | WP_000259631.1 | phage baseplate upper protein | - |
| CH51_RS06015 (CH51_05775) | - | 1187547..1187924 (+) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| CH51_RS06020 | - | 1187928..1188101 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| CH51_RS06025 (CH51_05785) | - | 1188142..1188441 (+) | 300 | WP_000466770.1 | DUF2951 domain-containing protein | - |
| CH51_RS06030 (CH51_05790) | - | 1188578..1190476 (+) | 1899 | WP_000524017.1 | glucosaminidase domain-containing protein | - |
| CH51_RS06035 (CH51_05795) | - | 1190489..1191727 (+) | 1239 | WP_000276641.1 | BppU family phage baseplate upper protein | - |
| CH51_RS06040 (CH51_05800) | - | 1191732..1192127 (+) | 396 | WP_000398862.1 | hypothetical protein | - |
| CH51_RS06045 (CH51_05805) | - | 1192183..1192620 (+) | 438 | WP_000354121.1 | phage holin | - |
| CH51_RS06050 (CH51_05810) | - | 1192601..1194046 (+) | 1446 | WP_001148123.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=120002 CH51_RS05825 WP_000934764.1 1161630..1162100(+) (ssbA) [Staphylococcus aureus strain 2395 USA500]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=120002 CH51_RS05825 WP_000934764.1 1161630..1162100(+) (ssbA) [Staphylococcus aureus strain 2395 USA500]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |