Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB1101_RS04660 | Genome accession | NZ_CP007240 |
| Coordinates | 939959..940147 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain 7F7 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 932371..963391 | 939959..940147 | within | 0 |
Gene organization within MGE regions
Location: 932371..963391
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB1101_RS04630 (STAB1101_04630) | pfkA | 932371..933384 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| STAB1101_RS04635 (STAB1101_04635) | - | 933464..936574 (-) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| STAB1101_RS04640 (STAB1101_04640) | - | 936759..937130 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| STAB1101_RS04645 (STAB1101_04645) | - | 937130..937828 (+) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
| STAB1101_RS04650 (STAB1101_04650) | - | 937838..938623 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| STAB1101_RS04655 (STAB1101_04655) | - | 938754..939368 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| STAB1101_RS04660 (STAB1101_04660) | prx | 939959..940147 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| STAB1101_RS04665 (STAB1101_04665) | spel | 940262..941050 (-) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| STAB1101_RS04670 (STAB1101_04670) | spem | 941332..942045 (-) | 714 | WP_038431384.1 | streptococcal pyrogenic exotoxin SpeM | - |
| STAB1101_RS04675 (STAB1101_04675) | - | 942349..943215 (-) | 867 | WP_038431386.1 | DUF334 domain-containing protein | - |
| STAB1101_RS04680 (STAB1101_04680) | - | 943203..943727 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| STAB1101_RS04685 (STAB1101_04685) | - | 943867..945075 (-) | 1209 | WP_038431388.1 | glucosaminidase domain-containing protein | - |
| STAB1101_RS04695 (STAB1101_04695) | - | 945191..945418 (-) | 228 | WP_000609113.1 | phage holin | - |
| STAB1101_RS04700 (STAB1101_04700) | - | 945415..945690 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| STAB1101_RS04705 (STAB1101_04705) | - | 945700..946317 (-) | 618 | WP_038431396.1 | DUF1366 domain-containing protein | - |
| STAB1101_RS08470 | - | 946320..946481 (-) | 162 | WP_002987333.1 | hypothetical protein | - |
| STAB1101_RS04710 (STAB1101_04710) | - | 946495..947640 (-) | 1146 | Protein_894 | gp58-like family protein | - |
| STAB1101_RS09040 | - | 947661..947892 (-) | 232 | Protein_895 | hypothetical protein | - |
| STAB1101_RS04715 (STAB1101_04715) | - | 947889..948245 (-) | 357 | WP_032462868.1 | hypothetical protein | - |
| STAB1101_RS04720 (STAB1101_04720) | - | 948229..948513 (-) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| STAB1101_RS04725 (STAB1101_04725) | - | 948533..949402 (-) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| STAB1101_RS04730 (STAB1101_04730) | - | 949680..951233 (-) | 1554 | WP_002984332.1 | hypothetical protein | - |
| STAB1101_RS04735 (STAB1101_04735) | - | 951251..951733 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| STAB1101_RS04740 (STAB1101_04740) | - | 951738..953171 (-) | 1434 | Protein_901 | DEAD/DEAH box helicase | - |
| STAB1101_RS04745 (STAB1101_04745) | - | 953177..953860 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| STAB1101_RS04750 (STAB1101_04750) | - | 953857..954141 (-) | 285 | WP_002984318.1 | hypothetical protein | - |
| STAB1101_RS04755 (STAB1101_04755) | - | 954138..954332 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| STAB1101_RS04760 (STAB1101_04760) | - | 954332..954661 (-) | 330 | WP_002984312.1 | hypothetical protein | - |
| STAB1101_RS08480 | - | 954742..954879 (-) | 138 | WP_002984309.1 | hypothetical protein | - |
| STAB1101_RS04765 (STAB1101_04765) | - | 954876..955172 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| STAB1101_RS04770 (STAB1101_04770) | - | 955250..955426 (-) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| STAB1101_RS04775 (STAB1101_04775) | - | 955569..955787 (+) | 219 | WP_023079659.1 | hypothetical protein | - |
| STAB1101_RS04780 (STAB1101_04780) | - | 955963..956172 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| STAB1101_RS04790 (STAB1101_04790) | - | 956431..956940 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| STAB1101_RS04795 (STAB1101_04795) | - | 957071..957280 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| STAB1101_RS04800 (STAB1101_04800) | - | 957390..957590 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| STAB1101_RS04805 (STAB1101_04805) | - | 957664..958050 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| STAB1101_RS04810 (STAB1101_04810) | - | 958039..958248 (-) | 210 | WP_038431402.1 | hypothetical protein | - |
| STAB1101_RS04815 (STAB1101_04815) | - | 958302..958901 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| STAB1101_RS08485 | - | 958931..959089 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| STAB1101_RS04820 (STAB1101_04820) | - | 959446..960270 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| STAB1101_RS04825 (STAB1101_04825) | - | 960306..961199 (+) | 894 | WP_038431403.1 | P63C domain-containing protein | - |
| STAB1101_RS04830 (STAB1101_04830) | - | 961320..962408 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| STAB1101_RS04835 (STAB1101_04835) | - | 962771..963391 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=118037 STAB1101_RS04660 WP_011054546.1 939959..940147(-) (prx) [Streptococcus pyogenes strain 7F7]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=118037 STAB1101_RS04660 WP_011054546.1 939959..940147(-) (prx) [Streptococcus pyogenes strain 7F7]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |