Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | ACLV7W_RS10810 | Genome accession | NZ_OZ217346 |
| Coordinates | 2217167..2217292 (-) | Length | 41 a.a. |
| NCBI ID | WP_411865927.1 | Uniprot ID | - |
| Organism | Streptococcus mitis isolate S. mitis D22 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2212167..2222292
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLV7W_RS10785 (SMID22_22160) | - | 2214294..2214836 (+) | 543 | WP_001158275.1 | TetR/AcrR family transcriptional regulator | - |
| ACLV7W_RS10800 (SMID22_22190) | comE | 2215079..2215831 (-) | 753 | WP_000866073.1 | competence system response regulator transcription factor ComE | Regulator |
| ACLV7W_RS10805 (SMID22_22200) | comD | 2215828..2217147 (-) | 1320 | WP_411865926.1 | competence system sensor histidine kinase ComD | Regulator |
| ACLV7W_RS10810 (SMID22_22210) | comC/comC1 | 2217167..2217292 (-) | 126 | WP_411865927.1 | competence-stimulating peptide ComC | Regulator |
| ACLV7W_RS10820 (SMID22_22230) | rlmH | 2217575..2218054 (-) | 480 | WP_000695928.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACLV7W_RS10825 (SMID22_22240) | htrA | 2218238..2219419 (+) | 1182 | WP_000681589.1 | S1C family serine protease | Regulator |
| ACLV7W_RS10830 (SMID22_22250) | spo0J | 2219477..2220235 (+) | 759 | WP_000410371.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4882.79 Da Isoelectric Point: 10.7877
>NTDB_id=1170483 ACLV7W_RS10810 WP_411865927.1 2217167..2217292(-) (comC/comC1) [Streptococcus mitis isolate S. mitis D22]
MKNTVKLEQFVALKEKDLQEIKGGDSRISKFLRDFIFPRKK
MKNTVKLEQFVALKEKDLQEIKGGDSRISKFLRDFIFPRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1170483 ACLV7W_RS10810 WP_411865927.1 2217167..2217292(-) (comC/comC1) [Streptococcus mitis isolate S. mitis D22]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTAAAGGTGGGGATAGCAG
GATATCAAAATTCCTCCGTGATTTTATTTTCCCAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTAAAGGTGGGGATAGCAG
GATATCAAAATTCCTCCGTGATTTTATTTTCCCAAGAAAAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae G54 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae D39 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
82.927 |
100 |
0.829 |
| comC | Streptococcus mitis SK321 |
82.927 |
100 |
0.829 |
| comC/comC2 | Streptococcus pneumoniae A66 |
78.049 |
100 |
0.78 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
70.37 |
65.854 |
0.463 |