Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | ACLV7A_RS09915 | Genome accession | NZ_OZ217344 |
| Coordinates | 2081448..2081573 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799687.1 | Uniprot ID | A0A1S9ZPR2 |
| Organism | Streptococcus mitis isolate S. mitis E22 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2076448..2086573
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLV7A_RS09890 (SMIE22_19800) | - | 2078568..2079110 (+) | 543 | WP_001158275.1 | TetR/AcrR family transcriptional regulator | - |
| ACLV7A_RS09905 (SMIE22_19830) | comE | 2079353..2080105 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| ACLV7A_RS09910 (SMIE22_19840) | comD/comD2 | 2080102..2081427 (-) | 1326 | WP_050242851.1 | competence system sensor histidine kinase ComD | Regulator |
| ACLV7A_RS09915 (SMIE22_19850) | comC/comC1 | 2081448..2081573 (-) | 126 | WP_000799687.1 | competence-stimulating peptide ComC | Regulator |
| ACLV7A_RS09925 (SMIE22_19870) | rlmH | 2081854..2082333 (-) | 480 | WP_411864199.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACLV7A_RS09930 (SMIE22_19880) | htrA | 2082516..2083697 (+) | 1182 | WP_050242853.1 | S1C family serine protease | Regulator |
| ACLV7A_RS09935 (SMIE22_19890) | spo0J | 2083755..2084513 (+) | 759 | WP_050252627.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4916.01 Da Isoelectric Point: 11.0775
>NTDB_id=1170323 ACLV7A_RS09915 WP_000799687.1 2081448..2081573(-) (comC/comC1) [Streptococcus mitis isolate S. mitis E22]
MKNTVKLEQFVALKEKDLQKIKGGEMRLPKILRDFIFPRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLPKILRDFIFPRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1170323 ACLV7A_RS09915 WP_000799687.1 2081448..2081573(-) (comC/comC1) [Streptococcus mitis isolate S. mitis E22]
ATGAAAAATACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAATGAG
ACTTCCAAAAATCCTCCGTGATTTTATTTTCCCAAGAAAAAAGTAA
ATGAAAAATACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAATGAG
ACTTCCAAAAATCCTCCGTGATTTTATTTTCCCAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
87.805 |
100 |
0.878 |
| comC/comC1 | Streptococcus pneumoniae G54 |
87.805 |
100 |
0.878 |
| comC/comC1 | Streptococcus pneumoniae D39 |
87.805 |
100 |
0.878 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
87.805 |
100 |
0.878 |
| comC | Streptococcus mitis SK321 |
87.805 |
100 |
0.878 |
| comC/comC2 | Streptococcus pneumoniae A66 |
82.927 |
100 |
0.829 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
82.927 |
100 |
0.829 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |