Detailed information NTG1169836

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: ACKWRP_RS00375
• Genome accession: NZ_OZ205032
• Coordinates: 70382..70963 (+)
• Length: 193 a.a.
• NCBI ID: WP_001049162.1
• Uniprot ID: A0A9W5QPC2
• Organism: Bacillus cereus biovar anthracis isolate BcbvaCA
• Function: degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 65382..75963

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKWRP_RS00340	-	66377..66583 (+)	207	WP_000216166.1	DUF1657 domain-containing protein	-
ACKWRP_RS00345	-	66677..67162 (+)	486	WP_001228539.1	YhcN/YlaJ family sporulation lipoprotein	-
ACKWRP_RS00350	spoVAC	67192..67668 (+)	477	WP_000095399.1	stage V sporulation protein AC	-
ACKWRP_RS00355	spoVAD	67669..68685 (+)	1017	WP_000938965.1	stage V sporulation protein AD	-
ACKWRP_RS00360	spoVAE	68682..69032 (+)	351	WP_000575919.1	stage V sporulation protein AE	-
ACKWRP_RS00365	-	69044..69250 (+)	207	WP_000215915.1	DUF1657 domain-containing protein	-
ACKWRP_RS00370	-	69271..70140 (+)	870	WP_000018934.1	DUF421 domain-containing protein	-
ACKWRP_RS00375	clpP	70382..70963 (+)	582	WP_001049162.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
ACKWRP_RS00380	-	71368..71616 (-)	249	WP_000250307.1	HPr family phosphocarrier protein	-
ACKWRP_RS00385	whiA	71640..72590 (-)	951	WP_000006561.1	DNA-binding protein WhiA	-
ACKWRP_RS00390	yvcK	72680..73633 (-)	954	WP_000712177.1	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	-
ACKWRP_RS00395	rapZ	73637..74518 (-)	882	WP_000138464.1	RNase adapter RapZ	-
ACKWRP_RS00400	-	74539..74997 (-)	459	WP_001190080.1	NUDIX hydrolase	-

Sequence

Protein

• Length: 193 a.a.
• Molecular weight: 21419.67 Da
• Isoelectric Point: 5.0423

>NTDB_id=1169836 ACKWRP_RS00375 WP_001049162.1 70382..70963(+) (clpP) [Bacillus cereus biovar anthracis isolate BcbvaCA]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR

Nucleotide

• Length: 582 bp

>NTDB_id=1169836 ACKWRP_RS00375 WP_001049162.1 70382..70963(+) (clpP) [Bacillus cereus biovar anthracis isolate BcbvaCA]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGTGGTGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATTCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (13-192)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Bacillus subtilis subsp. subtilis str. 168	90.104	99.482	0.896
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	67.021	97.409	0.653
clpP	Streptococcus thermophilus LMG 18311	60.417	99.482	0.601
clpP	Streptococcus thermophilus LMD-9	60.417	99.482	0.601
clpP	Lactococcus lactis subsp. cremoris KW2	58.854	99.482	0.585
clpP	Streptococcus pneumoniae D39	57.292	99.482	0.57
clpP	Streptococcus pneumoniae Rx1	57.292	99.482	0.57
clpP	Streptococcus pneumoniae R6	57.292	99.482	0.57
clpP	Streptococcus pneumoniae TIGR4	57.292	99.482	0.57
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	56.771	99.482	0.565
clpP	Streptococcus pyogenes JRS4	55.729	99.482	0.554
clpP	Streptococcus pyogenes MGAS315	55.729	99.482	0.554
clpP	Streptococcus mutans UA159	55.44	100	0.554