Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB902_RS05815 | Genome accession | NZ_CP007041 |
| Coordinates | 1107014..1107202 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes STAB902 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1099426..1146612 | 1107014..1107202 | within | 0 |
Gene organization within MGE regions
Location: 1099426..1146612
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB902_RS05785 (STAB902_06060) | pfkA | 1099426..1100439 (-) | 1014 | WP_011054544.1 | 6-phosphofructokinase | - |
| STAB902_RS05790 (STAB902_06065) | - | 1100519..1103629 (-) | 3111 | WP_011054545.1 | DNA polymerase III subunit alpha | - |
| STAB902_RS05795 (STAB902_06070) | - | 1103814..1104185 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| STAB902_RS05800 (STAB902_06075) | - | 1104185..1104883 (+) | 699 | WP_032463848.1 | ABC transporter ATP-binding protein | - |
| STAB902_RS05805 (STAB902_06080) | - | 1104893..1105678 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| STAB902_RS05810 (STAB902_06085) | - | 1105809..1106423 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| STAB902_RS05815 (STAB902_06090) | prx | 1107014..1107202 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| STAB902_RS05820 (STAB902_06095) | entC3 | 1107315..1108097 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| STAB902_RS05825 (STAB902_06100) | - | 1108310..1109434 (-) | 1125 | WP_011054547.1 | Fic family protein | - |
| STAB902_RS05830 (STAB902_06105) | - | 1109572..1110780 (-) | 1209 | WP_038432212.1 | glucosaminidase domain-containing protein | - |
| STAB902_RS05840 (STAB902_06115) | - | 1110896..1111123 (-) | 228 | WP_003058873.1 | phage holin | - |
| STAB902_RS05845 (STAB902_06120) | - | 1111120..1111395 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| STAB902_RS10110 (STAB902_06125) | - | 1111405..1112047 (-) | 643 | Protein_1127 | hypothetical protein | - |
| STAB902_RS05860 (STAB902_06130) | - | 1112050..1112478 (-) | 429 | WP_032463849.1 | DUF1617 family protein | - |
| STAB902_RS05865 (STAB902_06135) | - | 1112490..1114394 (-) | 1905 | WP_011054442.1 | gp58-like family protein | - |
| STAB902_RS05870 (STAB902_06140) | - | 1114404..1115411 (-) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| STAB902_RS05875 (STAB902_06145) | - | 1115408..1117459 (-) | 2052 | WP_011054440.1 | phage tail spike protein | - |
| STAB902_RS05880 (STAB902_06150) | - | 1117456..1118226 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| STAB902_RS05885 (STAB902_06155) | - | 1118239..1122339 (-) | 4101 | WP_011054439.1 | phage tail tape measure protein | - |
| STAB902_RS05895 (STAB902_06165) | gpG | 1122565..1122867 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| STAB902_RS05900 (STAB902_06170) | - | 1122960..1123544 (-) | 585 | WP_011017389.1 | major tail protein | - |
| STAB902_RS05905 (STAB902_06175) | - | 1123556..1123936 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| STAB902_RS05910 (STAB902_06180) | - | 1123929..1124327 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| STAB902_RS05915 (STAB902_06185) | - | 1124329..1124691 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| STAB902_RS05920 (STAB902_06190) | - | 1124684..1124992 (-) | 309 | WP_011054437.1 | hypothetical protein | - |
| STAB902_RS10260 | - | 1124992..1125165 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| STAB902_RS05925 (STAB902_06200) | - | 1125179..1126312 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| STAB902_RS05930 (STAB902_06205) | - | 1126329..1127135 (-) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| STAB902_RS05935 (STAB902_06210) | - | 1127116..1128303 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| STAB902_RS05940 (STAB902_06215) | - | 1128456..1128668 (-) | 213 | WP_136260634.1 | hypothetical protein | - |
| STAB902_RS05945 (STAB902_06220) | - | 1128671..1130401 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| STAB902_RS05950 (STAB902_06225) | - | 1130414..1130731 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| STAB902_RS05955 (STAB902_06230) | - | 1130872..1131177 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| STAB902_RS05960 (STAB902_06235) | - | 1131170..1131556 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| STAB902_RS05965 (STAB902_06240) | - | 1131582..1131785 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| STAB902_RS05970 (STAB902_06245) | - | 1131843..1132136 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| STAB902_RS05975 (STAB902_06250) | - | 1132290..1132865 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| STAB902_RS05980 (STAB902_06255) | - | 1133025..1133426 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| STAB902_RS05985 (STAB902_06260) | - | 1133441..1134268 (-) | 828 | WP_011054433.1 | prohibitin family protein | - |
| STAB902_RS05990 (STAB902_06265) | - | 1134270..1134608 (-) | 339 | WP_011054432.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS05995 (STAB902_06270) | - | 1134605..1134886 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| STAB902_RS06000 (STAB902_06275) | - | 1134901..1135092 (-) | 192 | Protein_1156 | single-stranded DNA-binding protein | - |
| STAB902_RS06005 | - | 1135052..1135564 (-) | 513 | WP_011054429.1 | DUF1642 domain-containing protein | - |
| STAB902_RS06010 (STAB902_06285) | - | 1135569..1136201 (-) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| STAB902_RS06015 (STAB902_06290) | - | 1136203..1136487 (-) | 285 | WP_011054427.1 | hypothetical protein | - |
| STAB902_RS06020 (STAB902_06295) | - | 1136484..1136918 (-) | 435 | WP_011054426.1 | YopX family protein | - |
| STAB902_RS06025 (STAB902_06300) | - | 1136935..1137141 (-) | 207 | WP_011054425.1 | hypothetical protein | - |
| STAB902_RS06030 (STAB902_06305) | - | 1137155..1137382 (-) | 228 | WP_011054424.1 | hypothetical protein | - |
| STAB902_RS10375 (STAB902_06310) | - | 1137382..1138194 (-) | 813 | Protein_1163 | ATP-binding protein | - |
| STAB902_RS06040 (STAB902_06315) | - | 1138194..1138955 (-) | 762 | WP_011054422.1 | conserved phage C-terminal domain-containing protein | - |
| STAB902_RS06045 (STAB902_06320) | dnaB | 1138948..1140288 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| STAB902_RS06050 (STAB902_06325) | - | 1140275..1140463 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| STAB902_RS06055 (STAB902_06330) | - | 1140584..1140775 (-) | 192 | WP_011017359.1 | hypothetical protein | - |
| STAB902_RS06060 (STAB902_06340) | - | 1140868..1141125 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| STAB902_RS06065 (STAB902_06345) | - | 1141199..1141918 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| STAB902_RS06070 (STAB902_06350) | - | 1141960..1142469 (+) | 510 | WP_011106801.1 | hypothetical protein | - |
| STAB902_RS10500 | - | 1142589..1142723 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| STAB902_RS06075 (STAB902_06365) | - | 1142797..1143009 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS06080 (STAB902_06370) | - | 1143044..1143319 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| STAB902_RS06085 (STAB902_06375) | - | 1143608..1143958 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS06090 (STAB902_06380) | - | 1143962..1144354 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| STAB902_RS06095 (STAB902_06385) | - | 1144365..1145105 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| STAB902_RS06100 (STAB902_06390) | - | 1145416..1146612 (+) | 1197 | WP_011017350.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=116271 STAB902_RS05815 WP_011054546.1 1107014..1107202(-) (prx) [Streptococcus pyogenes STAB902]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=116271 STAB902_RS05815 WP_011054546.1 1107014..1107202(-) (prx) [Streptococcus pyogenes STAB902]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |