Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB902_RS04905 | Genome accession | NZ_CP007041 |
| Coordinates | 918918..919100 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes STAB902 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 878563..918719 | 918918..919100 | flank | 199 |
Gene organization within MGE regions
Location: 878563..919100
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB902_RS04615 (STAB902_04830) | - | 878563..879651 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| STAB902_RS04620 (STAB902_04835) | - | 879771..880076 (-) | 306 | WP_011106738.1 | membrane protein | - |
| STAB902_RS04625 (STAB902_04840) | - | 880086..880874 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| STAB902_RS09840 | - | 881246..881392 (+) | 147 | WP_011054593.1 | hypothetical protein | - |
| STAB902_RS04630 (STAB902_04855) | - | 881526..882305 (-) | 780 | WP_011054591.1 | hypothetical protein | - |
| STAB902_RS04635 (STAB902_04860) | - | 882362..882568 (+) | 207 | WP_011054590.1 | hypothetical protein | - |
| STAB902_RS04640 (STAB902_04865) | - | 882557..882943 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| STAB902_RS04645 (STAB902_04870) | - | 883017..883256 (+) | 240 | WP_011054588.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS04655 (STAB902_04880) | - | 883472..883681 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| STAB902_RS04660 (STAB902_04890) | - | 883832..884071 (-) | 240 | WP_011054586.1 | hypothetical protein | - |
| STAB902_RS04665 (STAB902_04895) | - | 884238..884423 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS04670 (STAB902_04900) | - | 884501..884797 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| STAB902_RS10485 | - | 884794..884928 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| STAB902_RS04675 (STAB902_04910) | - | 884944..885258 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| STAB902_RS04680 (STAB902_04915) | - | 885487..885969 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| STAB902_RS04685 (STAB902_04920) | - | 885970..886650 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| STAB902_RS04690 (STAB902_04925) | - | 886752..887981 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| STAB902_RS04695 (STAB902_04930) | - | 887997..888455 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| STAB902_RS04700 (STAB902_04935) | - | 888458..889270 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| STAB902_RS10620 (STAB902_04940) | - | 889260..889814 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| STAB902_RS09845 (STAB902_04945) | - | 889742..890734 (+) | 993 | WP_229309934.1 | phage/plasmid primase, P4 family | - |
| STAB902_RS04715 (STAB902_04950) | - | 890996..891409 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| STAB902_RS04720 (STAB902_04955) | - | 891406..891726 (+) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| STAB902_RS04725 | - | 891710..891913 (+) | 204 | WP_011054575.1 | hypothetical protein | - |
| STAB902_RS04730 (STAB902_04965) | - | 891910..892194 (+) | 285 | WP_011106747.1 | hypothetical protein | - |
| STAB902_RS04735 (STAB902_04970) | - | 892219..892593 (+) | 375 | WP_011054574.1 | methyltransferase domain-containing protein | - |
| STAB902_RS04740 (STAB902_04980) | - | 892784..893185 (+) | 402 | WP_011054573.1 | hypothetical protein | - |
| STAB902_RS04745 (STAB902_04985) | - | 893185..893820 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| STAB902_RS04750 (STAB902_04990) | - | 894093..894533 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| STAB902_RS04760 (STAB902_05000) | - | 895119..895457 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| STAB902_RS04765 (STAB902_05005) | - | 895629..896096 (+) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| STAB902_RS04770 (STAB902_05010) | - | 896111..897865 (+) | 1755 | WP_011054568.1 | terminase large subunit | - |
| STAB902_RS10240 | - | 897862..898032 (+) | 171 | WP_011054567.1 | hypothetical protein | - |
| STAB902_RS04775 (STAB902_05020) | - | 898025..898291 (+) | 267 | WP_011054566.1 | hypothetical protein | - |
| STAB902_RS04780 (STAB902_05025) | - | 898325..899545 (+) | 1221 | WP_011054565.1 | phage portal protein | - |
| STAB902_RS04785 (STAB902_05030) | - | 899523..900188 (+) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| STAB902_RS04790 (STAB902_05035) | - | 900214..901398 (+) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| STAB902_RS10490 | - | 901412..901540 (+) | 129 | WP_011054562.1 | hypothetical protein | - |
| STAB902_RS04795 (STAB902_05045) | - | 901543..901845 (+) | 303 | WP_011054561.1 | head-tail connector protein | - |
| STAB902_RS04800 (STAB902_05050) | - | 901842..902180 (+) | 339 | WP_011054560.1 | phage head closure protein | - |
| STAB902_RS04805 (STAB902_05055) | - | 902177..902554 (+) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| STAB902_RS04810 (STAB902_05060) | - | 902551..902976 (+) | 426 | WP_011054558.1 | hypothetical protein | - |
| STAB902_RS04815 (STAB902_05065) | - | 902995..903606 (+) | 612 | WP_011054557.1 | major tail protein | - |
| STAB902_RS04820 (STAB902_05070) | gpG | 903659..903985 (+) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| STAB902_RS10245 | - | 904033..904182 (+) | 150 | WP_023609816.1 | hypothetical protein | - |
| STAB902_RS04830 (STAB902_05080) | - | 904195..908118 (+) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| STAB902_RS04835 (STAB902_05085) | - | 908118..908825 (+) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| STAB902_RS04840 (STAB902_05090) | - | 908822..910966 (+) | 2145 | WP_038432207.1 | phage tail spike protein | - |
| STAB902_RS04845 (STAB902_05095) | hylP | 910963..911976 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| STAB902_RS04850 (STAB902_05100) | - | 911991..913874 (+) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| STAB902_RS04855 (STAB902_05105) | - | 913886..914332 (+) | 447 | WP_038432208.1 | DUF1617 family protein | - |
| STAB902_RS04860 (STAB902_05110) | - | 914335..914952 (+) | 618 | Protein_930 | DUF1366 domain-containing protein | - |
| STAB902_RS04865 (STAB902_05115) | - | 914962..915237 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| STAB902_RS04870 (STAB902_05120) | - | 915234..915461 (+) | 228 | WP_003058873.1 | phage holin | - |
| STAB902_RS04880 (STAB902_05130) | - | 915577..916785 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| STAB902_RS04885 (STAB902_05135) | - | 916901..917257 (-) | 357 | WP_011054446.1 | hypothetical protein | - |
| STAB902_RS04890 (STAB902_05140) | - | 917315..917554 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| STAB902_RS04895 (STAB902_05145) | - | 917818..918069 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| STAB902_RS10250 | - | 918210..918356 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| STAB902_RS04900 (STAB902_05155) | - | 918510..918719 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS04905 (STAB902_05160) | prx | 918918..919100 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=116267 STAB902_RS04905 WP_029714017.1 918918..919100(+) (prx) [Streptococcus pyogenes STAB902]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=116267 STAB902_RS04905 WP_029714017.1 918918..919100(+) (prx) [Streptococcus pyogenes STAB902]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |