Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB902_RS04070 | Genome accession | NZ_CP007041 |
| Coordinates | 759082..759264 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes STAB902 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 723252..759264 | 759082..759264 | within | 0 |
Gene organization within MGE regions
Location: 723252..759264
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB902_RS03805 (STAB902_03970) | - | 723270..724112 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| STAB902_RS03810 (STAB902_03975) | - | 724090..724677 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| STAB902_RS03815 (STAB902_03980) | - | 724776..725051 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| STAB902_RS03820 (STAB902_03985) | - | 725140..726282 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| STAB902_RS03825 (STAB902_03990) | - | 726406..726924 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| STAB902_RS03830 (STAB902_03995) | - | 726936..727691 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS03835 (STAB902_04000) | - | 727893..728105 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS03840 (STAB902_04010) | - | 728375..728686 (+) | 312 | WP_010922478.1 | excisionase | - |
| STAB902_RS03845 (STAB902_04015) | - | 728688..728873 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| STAB902_RS10355 (STAB902_04020) | - | 728967..729236 (+) | 270 | WP_011106700.1 | replication protein | - |
| STAB902_RS03855 (STAB902_04025) | - | 729377..729763 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| STAB902_RS03860 (STAB902_04030) | - | 729744..729977 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| STAB902_RS10090 | - | 729974..730114 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| STAB902_RS03865 (STAB902_04040) | - | 730123..730329 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| STAB902_RS03870 (STAB902_04045) | - | 730385..730715 (+) | 331 | Protein_731 | hypothetical protein | - |
| STAB902_RS03875 (STAB902_04050) | - | 730718..731644 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| STAB902_RS03880 (STAB902_04055) | - | 731641..731841 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| STAB902_RS03885 (STAB902_04060) | - | 731834..732631 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| STAB902_RS03890 (STAB902_04070) | - | 732996..733391 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| STAB902_RS03895 (STAB902_04075) | - | 733388..734734 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| STAB902_RS03900 (STAB902_04080) | - | 734745..735077 (+) | 333 | WP_011054696.1 | hypothetical protein | - |
| STAB902_RS03905 (STAB902_04085) | - | 735074..735586 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| STAB902_RS03910 (STAB902_04090) | - | 735622..735939 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| STAB902_RS10225 | - | 735936..736091 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| STAB902_RS03915 (STAB902_04100) | - | 736088..736339 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| STAB902_RS03920 (STAB902_04105) | - | 736415..736834 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| STAB902_RS03925 (STAB902_04110) | - | 736942..737286 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| STAB902_RS03930 (STAB902_04115) | - | 737434..737790 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| STAB902_RS03935 (STAB902_04120) | - | 737787..739055 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| STAB902_RS03940 (STAB902_04125) | - | 739048..740541 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| STAB902_RS03945 (STAB902_04130) | - | 740547..740771 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| STAB902_RS10230 | - | 740848..741000 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| STAB902_RS03950 (STAB902_04140) | - | 740993..741259 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| STAB902_RS03955 (STAB902_04145) | - | 741261..741476 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| STAB902_RS03960 (STAB902_04150) | - | 741558..742973 (+) | 1416 | WP_011054685.1 | terminase | - |
| STAB902_RS03965 (STAB902_04155) | - | 743054..743515 (+) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| STAB902_RS03970 (STAB902_04160) | - | 743540..744451 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| STAB902_RS03975 (STAB902_04165) | - | 744451..744651 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| STAB902_RS03980 (STAB902_04170) | - | 744661..745083 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| STAB902_RS03985 (STAB902_04175) | - | 745043..745381 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| STAB902_RS03990 (STAB902_04180) | - | 745374..745610 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| STAB902_RS03995 (STAB902_04185) | - | 745611..745946 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| STAB902_RS04000 (STAB902_04190) | - | 745962..746552 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| STAB902_RS04005 (STAB902_04195) | - | 746563..746826 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| STAB902_RS04010 (STAB902_04200) | - | 746841..747212 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| STAB902_RS04015 (STAB902_04205) | - | 747212..749575 (+) | 2364 | WP_011054677.1 | hypothetical protein | - |
| STAB902_RS04020 (STAB902_04210) | - | 749572..750267 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| STAB902_RS04025 (STAB902_04215) | - | 750249..752222 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| STAB902_RS04030 (STAB902_04220) | - | 752222..753331 (+) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| STAB902_RS04035 (STAB902_04225) | - | 753346..755127 (+) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| STAB902_RS04040 (STAB902_04230) | - | 755136..755567 (+) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| STAB902_RS04045 (STAB902_04235) | - | 755570..756184 (+) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| STAB902_RS04050 (STAB902_04240) | - | 756195..756650 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| STAB902_RS04060 (STAB902_04250) | - | 756762..757976 (+) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| STAB902_RS04065 (STAB902_04255) | - | 758221..759015 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| STAB902_RS04070 (STAB902_04260) | prx | 759082..759264 (+) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=116264 STAB902_RS04070 WP_011054671.1 759082..759264(+) (prx) [Streptococcus pyogenes STAB902]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=116264 STAB902_RS04070 WP_011054671.1 759082..759264(+) (prx) [Streptococcus pyogenes STAB902]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |