Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB902_RS03530 | Genome accession | NZ_CP007041 |
| Coordinates | 666522..666704 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes STAB902 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 625191..666704 | 666522..666704 | within | 0 |
Gene organization within MGE regions
Location: 625191..666704
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB902_RS03230 (STAB902_03370) | - | 625191..626288 (-) | 1098 | WP_015967409.1 | site-specific integrase | - |
| STAB902_RS03235 (STAB902_03375) | - | 626464..626985 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| STAB902_RS03240 (STAB902_03380) | - | 626996..627376 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| STAB902_RS03245 (STAB902_03385) | - | 627390..627743 (-) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS03250 (STAB902_03390) | - | 628545..628736 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| STAB902_RS03255 (STAB902_03395) | - | 628747..629475 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| STAB902_RS10210 | - | 629508..629657 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| STAB902_RS03260 (STAB902_03405) | - | 629654..629854 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| STAB902_RS09770 | - | 629930..630097 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| STAB902_RS03270 (STAB902_03415) | - | 630343..630600 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| STAB902_RS03275 (STAB902_03420) | - | 630629..630814 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| STAB902_RS09775 | - | 630908..631165 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| STAB902_RS03280 (STAB902_03425) | - | 631287..631700 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| STAB902_RS03285 (STAB902_03430) | - | 631681..631914 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| STAB902_RS10075 | - | 631911..632051 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| STAB902_RS03290 (STAB902_03440) | - | 632062..632316 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| STAB902_RS03295 (STAB902_03445) | - | 632338..632820 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| STAB902_RS03300 (STAB902_03450) | - | 632821..633495 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| STAB902_RS03305 (STAB902_03455) | ssbA | 633488..633907 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| STAB902_RS03310 (STAB902_03460) | - | 633913..634116 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| STAB902_RS03315 (STAB902_03465) | - | 634116..634556 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| STAB902_RS03320 (STAB902_03470) | - | 634553..634909 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| STAB902_RS03325 (STAB902_03475) | - | 634906..635157 (+) | 252 | WP_011054756.1 | hypothetical protein | - |
| STAB902_RS03330 (STAB902_03480) | - | 635151..635435 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| STAB902_RS03335 (STAB902_03485) | - | 635432..635701 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| STAB902_RS03340 (STAB902_03490) | - | 635711..636115 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| STAB902_RS10080 | - | 636112..636282 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| STAB902_RS03345 (STAB902_03500) | - | 636279..636785 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| STAB902_RS10215 | - | 636782..636952 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| STAB902_RS03350 (STAB902_03510) | - | 637226..637666 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| STAB902_RS09795 | - | 638305..638562 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| STAB902_RS03355 (STAB902_03515) | - | 638643..639161 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| STAB902_RS03360 (STAB902_03520) | - | 639140..639817 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| STAB902_RS10220 (STAB902_03525) | - | 639826..640209 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| STAB902_RS03370 (STAB902_03530) | - | 640270..640647 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| STAB902_RS03375 (STAB902_03535) | - | 640689..641171 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| STAB902_RS03380 (STAB902_03545) | - | 641254..642465 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| STAB902_RS03385 (STAB902_03550) | - | 642479..643981 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| STAB902_RS03390 (STAB902_03555) | - | 643986..645464 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| STAB902_RS03395 (STAB902_03560) | - | 645436..645675 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| STAB902_RS03400 (STAB902_03565) | - | 645737..646003 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| STAB902_RS03405 (STAB902_03570) | - | 646129..646743 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| STAB902_RS03410 (STAB902_03575) | - | 646747..647565 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| STAB902_RS03415 (STAB902_03580) | - | 647619..648035 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| STAB902_RS03420 (STAB902_03585) | - | 648025..648357 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| STAB902_RS03425 (STAB902_03590) | - | 648357..648713 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| STAB902_RS03430 (STAB902_03595) | - | 648710..649108 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| STAB902_RS03435 (STAB902_03600) | - | 649108..649593 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| STAB902_RS03440 (STAB902_03605) | - | 649632..650066 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| STAB902_RS03445 (STAB902_03610) | - | 650070..650651 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| STAB902_RS03450 (STAB902_03615) | - | 650641..653901 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| STAB902_RS03455 (STAB902_03620) | - | 653898..654615 (+) | 718 | Protein_649 | distal tail protein Dit | - |
| STAB902_RS03460 (STAB902_03625) | - | 654612..656757 (+) | 2146 | Protein_650 | phage tail spike protein | - |
| STAB902_RS03465 (STAB902_03630) | hylP | 656754..657767 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| STAB902_RS03470 (STAB902_03635) | - | 657782..659665 (+) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| STAB902_RS03475 (STAB902_03640) | - | 659677..660108 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| STAB902_RS03480 (STAB902_03645) | - | 660111..660722 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| STAB902_RS03485 (STAB902_03650) | - | 660733..661029 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| STAB902_RS03490 (STAB902_03655) | - | 661026..661211 (+) | 186 | WP_011054731.1 | holin | - |
| STAB902_RS03500 (STAB902_03665) | - | 661322..662524 (+) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| STAB902_RS03505 (STAB902_03670) | - | 662664..663188 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| STAB902_RS03510 (STAB902_03675) | - | 663176..664042 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| STAB902_RS03515 (STAB902_03680) | spek | 664346..665125 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| STAB902_RS03520 (STAB902_03685) | - | 665601..666176 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| STAB902_RS03530 (STAB902_03695) | prx | 666522..666704 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=116261 STAB902_RS03530 WP_011054726.1 666522..666704(+) (prx) [Streptococcus pyogenes STAB902]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=116261 STAB902_RS03530 WP_011054726.1 666522..666704(+) (prx) [Streptococcus pyogenes STAB902]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |