Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB902_RS03060 | Genome accession | NZ_CP007041 |
| Coordinates | 583541..583723 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes STAB902 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545754..583723 | 583541..583723 | within | 0 |
Gene organization within MGE regions
Location: 545754..583723
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB902_RS02790 (STAB902_02900) | - | 545754..546920 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| STAB902_RS02795 (STAB902_02905) | - | 547094..547684 (-) | 591 | WP_009880743.1 | hypothetical protein | - |
| STAB902_RS10185 | - | 547953..548105 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| STAB902_RS02800 (STAB902_02920) | - | 548116..548493 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| STAB902_RS02805 (STAB902_02925) | - | 548477..548836 (-) | 360 | WP_011054823.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS02810 (STAB902_02930) | - | 549025..549243 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS02815 (STAB902_02935) | - | 549338..549589 (+) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| STAB902_RS10190 | - | 549620..549757 (+) | 138 | WP_011054821.1 | hypothetical protein | - |
| STAB902_RS10535 (STAB902_02945) | - | 549773..550088 (+) | 316 | Protein_516 | helix-turn-helix transcriptional regulator | - |
| STAB902_RS02825 (STAB902_02950) | - | 550317..550799 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| STAB902_RS02830 (STAB902_02955) | - | 550800..551480 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| STAB902_RS02835 (STAB902_02960) | - | 551582..552811 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| STAB902_RS02840 (STAB902_02965) | - | 552827..553285 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| STAB902_RS02845 (STAB902_02970) | - | 553288..554100 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| STAB902_RS09755 (STAB902_02980) | - | 554090..555570 (+) | 1481 | Protein_522 | phage/plasmid primase, P4 family | - |
| STAB902_RS02860 (STAB902_02985) | - | 555815..556135 (+) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| STAB902_RS02865 (STAB902_02990) | - | 556119..556475 (+) | 357 | WP_011054816.1 | hypothetical protein | - |
| STAB902_RS10540 (STAB902_02995) | - | 556472..556723 (+) | 252 | WP_011106665.1 | hypothetical protein | - |
| STAB902_RS02875 (STAB902_03000) | - | 556717..557001 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| STAB902_RS02880 (STAB902_03005) | - | 556998..557411 (+) | 414 | WP_011054815.1 | YopX family protein | - |
| STAB902_RS10195 | - | 557408..557578 (+) | 171 | WP_011054814.1 | hypothetical protein | - |
| STAB902_RS02885 (STAB902_03015) | - | 557575..557859 (+) | 285 | WP_032461310.1 | hypothetical protein | - |
| STAB902_RS02890 (STAB902_03020) | - | 557862..558197 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| STAB902_RS02895 (STAB902_03025) | - | 558363..558548 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| STAB902_RS02900 (STAB902_03030) | - | 558835..559338 (+) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| STAB902_RS10200 | - | 559335..559505 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| STAB902_RS02905 (STAB902_03040) | - | 559789..560223 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| STAB902_RS02910 (STAB902_03045) | - | 560833..561213 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| STAB902_RS09630 | - | 561203..562477 (+) | 1275 | Protein_536 | PBSX family phage terminase large subunit | - |
| STAB902_RS02925 (STAB902_03060) | - | 562477..563802 (+) | 1326 | WP_032461413.1 | phage portal protein | - |
| STAB902_RS02930 (STAB902_03065) | - | 563771..564679 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| STAB902_RS02935 (STAB902_03070) | - | 564686..564952 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| STAB902_RS02940 (STAB902_03075) | - | 565102..565674 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| STAB902_RS02945 (STAB902_03080) | - | 565692..566582 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| STAB902_RS02950 (STAB902_03085) | - | 566595..566888 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| STAB902_RS02955 (STAB902_03090) | - | 566902..567246 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| STAB902_RS02960 (STAB902_03095) | - | 567243..567554 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| STAB902_RS02965 (STAB902_03100) | - | 567551..567946 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| STAB902_RS02970 (STAB902_03105) | - | 567948..568358 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| STAB902_RS02975 (STAB902_03110) | - | 568370..568876 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| STAB902_RS02980 (STAB902_03115) | - | 568889..569206 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| STAB902_RS02985 (STAB902_03120) | - | 569179..569637 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| STAB902_RS02990 (STAB902_03125) | - | 569630..571435 (+) | 1806 | WP_011054802.1 | tail protein | - |
| STAB902_RS02995 (STAB902_03130) | - | 571436..572920 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| STAB902_RS03000 (STAB902_03135) | - | 572921..576361 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| STAB902_RS03005 (STAB902_03140) | - | 576366..578228 (+) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| STAB902_RS03010 (STAB902_03145) | - | 578239..578586 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| STAB902_RS10475 | - | 578600..578722 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| STAB902_RS03025 (STAB902_03160) | - | 579058..579390 (+) | 333 | WP_011054798.1 | phage holin | - |
| STAB902_RS03030 (STAB902_03165) | - | 579392..580156 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| STAB902_RS03035 (STAB902_03170) | - | 580168..580770 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| STAB902_RS03040 (STAB902_03175) | - | 580781..581554 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| STAB902_RS03045 (STAB902_03180) | - | 581564..581785 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| STAB902_RS03050 (STAB902_03185) | - | 581785..582444 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| STAB902_RS03055 (STAB902_03190) | speA | 582566..583321 (-) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| STAB902_RS03060 (STAB902_03195) | prx | 583541..583723 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=116259 STAB902_RS03060 WP_011054793.1 583541..583723(+) (prx) [Streptococcus pyogenes STAB902]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=116259 STAB902_RS03060 WP_011054793.1 583541..583723(+) (prx) [Streptococcus pyogenes STAB902]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |