Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | STAB902_RS02485 | Genome accession | NZ_CP007041 |
| Coordinates | 486097..486279 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes STAB902 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440724..486279 | 486097..486279 | within | 0 |
Gene organization within MGE regions
Location: 440724..486279
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAB902_RS02225 (STAB902_02305) | fsa | 440724..441368 (+) | 645 | WP_002983569.1 | fructose-6-phosphate aldolase | - |
| STAB902_RS02230 (STAB902_02310) | tkt | 441586..443571 (+) | 1986 | WP_011054904.1 | transketolase | - |
| STAB902_RS02235 (STAB902_02315) | - | 443764..443988 (+) | 225 | WP_011054903.1 | bacteriocin immunity protein | - |
| STAB902_RS02240 (STAB902_02320) | - | 444064..444798 (+) | 735 | WP_011054902.1 | ABC transporter ATP-binding protein | - |
| STAB902_RS02245 (STAB902_02325) | - | 444803..446431 (+) | 1629 | WP_011054901.1 | ABC transporter permease | - |
| STAB902_RS02250 (STAB902_02330) | - | 446574..447662 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| STAB902_RS02255 (STAB902_02335) | - | 447838..448389 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| STAB902_RS02260 (STAB902_02340) | - | 448400..448783 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| STAB902_RS02265 (STAB902_02345) | - | 448797..449147 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| STAB902_RS02270 (STAB902_02350) | - | 449786..449977 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| STAB902_RS02275 (STAB902_02355) | - | 450028..450228 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| STAB902_RS02280 (STAB902_02360) | - | 450316..450573 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| STAB902_RS09730 | - | 450602..450772 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| STAB902_RS02285 | - | 450765..450972 (+) | 208 | Protein_416 | hypothetical protein | - |
| STAB902_RS02290 (STAB902_02375) | - | 450969..451352 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| STAB902_RS02295 (STAB902_02385) | - | 451498..451701 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| STAB902_RS02300 (STAB902_02390) | - | 451789..452088 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| STAB902_RS02305 (STAB902_02395) | - | 452088..453245 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| STAB902_RS02310 (STAB902_02400) | - | 453259..453822 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| STAB902_RS02315 (STAB902_02405) | - | 453865..455787 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| STAB902_RS02320 (STAB902_02410) | - | 455792..458176 (+) | 2385 | WP_038432163.1 | phage/plasmid primase, P4 family | - |
| STAB902_RS02325 (STAB902_02415) | - | 458542..458817 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| STAB902_RS02330 (STAB902_02420) | - | 458814..460136 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| STAB902_RS10170 | - | 460137..460307 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| STAB902_RS02335 (STAB902_02430) | - | 460300..460572 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| STAB902_RS02340 (STAB902_02440) | - | 460705..461121 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| STAB902_RS02345 (STAB902_02445) | - | 461211..461663 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| STAB902_RS02350 (STAB902_02450) | - | 461653..462930 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| STAB902_RS02355 (STAB902_02455) | - | 462946..464478 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| STAB902_RS02360 (STAB902_02460) | - | 464438..465886 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| STAB902_RS02365 (STAB902_02465) | - | 465914..466102 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| STAB902_RS02370 (STAB902_02470) | - | 466107..466373 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| STAB902_RS02375 (STAB902_02475) | - | 466541..467110 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| STAB902_RS02380 (STAB902_02480) | - | 467123..468010 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| STAB902_RS02385 (STAB902_02485) | - | 468022..468378 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| STAB902_RS02390 (STAB902_02490) | - | 468389..468667 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| STAB902_RS02395 (STAB902_02495) | - | 468664..469008 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| STAB902_RS02400 (STAB902_02500) | - | 469012..469371 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| STAB902_RS02405 (STAB902_02505) | - | 469383..469982 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| STAB902_RS02410 (STAB902_02510) | - | 470036..470491 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| STAB902_RS02415 (STAB902_02515) | - | 470566..470799 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| STAB902_RS02420 (STAB902_02520) | - | 470814..475196 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| STAB902_RS02425 (STAB902_02525) | - | 475208..476050 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| STAB902_RS02430 (STAB902_02530) | - | 476060..478039 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| STAB902_RS02435 (STAB902_02535) | - | 478036..479043 (+) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| STAB902_RS02440 (STAB902_02540) | - | 479053..481068 (+) | 2016 | WP_038432168.1 | gp58-like family protein | - |
| STAB902_RS02445 (STAB902_02545) | - | 481080..481511 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| STAB902_RS02450 (STAB902_02550) | - | 481514..482125 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| STAB902_RS02455 (STAB902_02555) | - | 482136..482432 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| STAB902_RS02460 (STAB902_02560) | - | 482429..482614 (+) | 186 | WP_011054731.1 | holin | - |
| STAB902_RS02470 (STAB902_02570) | - | 482725..483927 (+) | 1203 | WP_038432171.1 | glucosaminidase domain-containing protein | - |
| STAB902_RS02475 (STAB902_02575) | - | 484249..484764 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| STAB902_RS02480 (STAB902_02580) | - | 484878..485864 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| STAB902_RS02485 (STAB902_02585) | prx | 486097..486279 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=116255 STAB902_RS02485 WP_011054856.1 486097..486279(+) (prx) [Streptococcus pyogenes STAB902]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=116255 STAB902_RS02485 WP_011054856.1 486097..486279(+) (prx) [Streptococcus pyogenes STAB902]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |