Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | QOR54_RS03380 | Genome accession | NZ_OX460968 |
| Coordinates | 592252..592431 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae isolate MRI Z2-342 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 554998..594010 | 592252..592431 | within | 0 |
Gene organization within MGE regions
Location: 554998..594010
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR54_RS03085 | - | 555016..555855 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| QOR54_RS03090 | - | 555830..556432 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| QOR54_RS03095 | - | 556535..556810 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| QOR54_RS03100 | - | 556898..558040 (-) | 1143 | WP_000269473.1 | site-specific integrase | - |
| QOR54_RS03105 | - | 558155..558706 (-) | 552 | WP_000353930.1 | hypothetical protein | - |
| QOR54_RS03110 | - | 558724..559110 (-) | 387 | WP_000151182.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QOR54_RS03115 | - | 559114..559461 (-) | 348 | WP_000484457.1 | helix-turn-helix transcriptional regulator | - |
| QOR54_RS03120 | - | 559757..560002 (+) | 246 | WP_000739596.1 | hypothetical protein | - |
| QOR54_RS03125 | - | 559953..560599 (-) | 647 | Protein_532 | hypothetical protein | - |
| QOR54_RS03130 | - | 560650..560841 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| QOR54_RS03135 | - | 560921..561232 (+) | 312 | WP_001123482.1 | hypothetical protein | - |
| QOR54_RS03140 | - | 561237..561386 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| QOR54_RS03145 | - | 561415..562173 (+) | 759 | WP_000546751.1 | DnaD domain protein | - |
| QOR54_RS03150 | - | 562160..562942 (+) | 783 | WP_000600244.1 | ATP-binding protein | - |
| QOR54_RS03155 | - | 562933..563079 (+) | 147 | WP_000424130.1 | hypothetical protein | - |
| QOR54_RS03160 | - | 563069..563344 (+) | 276 | WP_031463874.1 | hypothetical protein | - |
| QOR54_RS03165 | - | 563581..563754 (+) | 174 | WP_032459514.1 | hypothetical protein | - |
| QOR54_RS03170 | - | 563755..564237 (+) | 483 | WP_000323864.1 | siphovirus Gp157 family protein | - |
| QOR54_RS03175 | - | 564238..564912 (+) | 675 | WP_000063049.1 | ERF family protein | - |
| QOR54_RS03180 | ssb | 564905..565321 (+) | 417 | WP_000609372.1 | single-stranded DNA-binding protein | Machinery gene |
| QOR54_RS03185 | - | 565305..565529 (+) | 225 | WP_283571710.1 | hypothetical protein | - |
| QOR54_RS03190 | - | 565519..565995 (+) | 477 | WP_000143296.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QOR54_RS03195 | - | 565985..566332 (+) | 348 | WP_000129028.1 | hypothetical protein | - |
| QOR54_RS03200 | - | 566344..566640 (+) | 297 | WP_283571711.1 | nucleotide modification associated domain-containing protein | - |
| QOR54_RS03205 | - | 566624..566782 (+) | 159 | WP_017646174.1 | hypothetical protein | - |
| QOR54_RS03210 | - | 566779..567159 (+) | 381 | WP_000612375.1 | YopX family protein | - |
| QOR54_RS03215 | - | 567156..567293 (+) | 138 | WP_192804061.1 | hypothetical protein | - |
| QOR54_RS03220 | - | 567290..567466 (+) | 177 | WP_000159372.1 | hypothetical protein | - |
| QOR54_RS03225 | - | 567450..567668 (+) | 219 | WP_000806515.1 | hypothetical protein | - |
| QOR54_RS03230 | - | 567672..567854 (+) | 183 | WP_001114403.1 | hypothetical protein | - |
| QOR54_RS03235 | - | 567880..568245 (+) | 366 | WP_228316667.1 | hypothetical protein | - |
| QOR54_RS03240 | - | 568226..568609 (+) | 384 | WP_000164968.1 | hypothetical protein | - |
| QOR54_RS03245 | - | 568872..569315 (+) | 444 | WP_041981091.1 | KGG domain-containing protein | - |
| QOR54_RS03250 | - | 569302..570615 (+) | 1314 | WP_000691756.1 | PBSX family phage terminase large subunit | - |
| QOR54_RS03255 | - | 570627..572210 (+) | 1584 | WP_000052339.1 | phage portal protein | - |
| QOR54_RS03260 | - | 572309..573478 (+) | 1170 | WP_000140093.1 | phage minor capsid protein | - |
| QOR54_RS03265 | - | 573613..574191 (+) | 579 | WP_000011249.1 | phage scaffolding protein | - |
| QOR54_RS03270 | - | 574213..575097 (+) | 885 | WP_000224751.1 | hypothetical protein | - |
| QOR54_RS03275 | - | 575108..575365 (+) | 258 | WP_001269648.1 | hypothetical protein | - |
| QOR54_RS03280 | - | 575407..575796 (+) | 390 | WP_000221832.1 | hypothetical protein | - |
| QOR54_RS03285 | - | 575786..576112 (+) | 327 | WP_000565940.1 | putative minor capsid protein | - |
| QOR54_RS03290 | - | 576112..576477 (+) | 366 | WP_000064768.1 | minor capsid protein | - |
| QOR54_RS03295 | - | 576478..576885 (+) | 408 | WP_001180644.1 | minor capsid protein | - |
| QOR54_RS03300 | - | 576888..577343 (+) | 456 | Protein_567 | phage tail protein | - |
| QOR54_RS03305 | - | 577375..577773 (+) | 399 | WP_000069049.1 | hypothetical protein | - |
| QOR54_RS03310 | - | 577776..578360 (+) | 585 | WP_000459713.1 | Gp15 family bacteriophage protein | - |
| QOR54_RS03315 | - | 578379..582155 (+) | 3777 | WP_000763172.1 | tape measure protein | - |
| QOR54_RS03320 | - | 582148..583596 (+) | 1449 | WP_001293184.1 | distal tail protein Dit | - |
| QOR54_RS03325 | - | 583596..586397 (+) | 2802 | WP_283571712.1 | hypothetical protein | - |
| QOR54_RS03330 | - | 586408..588414 (+) | 2007 | WP_000536256.1 | DUF859 family phage minor structural protein | - |
| QOR54_RS03335 | - | 588427..588756 (+) | 330 | WP_000491467.1 | DUF1366 domain-containing protein | - |
| QOR54_RS03340 | - | 588731..588943 (+) | 213 | WP_000698337.1 | hypothetical protein | - |
| QOR54_RS03345 | - | 588956..589258 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| QOR54_RS03350 | - | 589260..589595 (+) | 336 | WP_001001965.1 | phage holin | - |
| QOR54_RS03355 | - | 589597..590316 (+) | 720 | WP_000236381.1 | peptidoglycan amidohydrolase family protein | - |
| QOR54_RS03360 | - | 590749..591261 (+) | 513 | WP_025194683.1 | PBECR4 domain-containing protein | - |
| QOR54_RS03365 | - | 591421..591621 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| QOR54_RS03370 | - | 591662..591832 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| QOR54_RS03375 | - | 591968..592093 (-) | 126 | WP_017646884.1 | hypothetical protein | - |
| QOR54_RS03380 | prx | 592252..592431 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| QOR54_RS03385 | - | 592837..593034 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| QOR54_RS03390 | - | 593078..594010 (-) | 933 | WP_000254063.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=1159379 QOR54_RS03380 WP_000965651.1 592252..592431(+) (prx) [Streptococcus agalactiae isolate MRI Z2-342]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1159379 QOR54_RS03380 WP_000965651.1 592252..592431(+) (prx) [Streptococcus agalactiae isolate MRI Z2-342]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |