Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | QOR61_RS03470 | Genome accession | NZ_OX460960 |
| Coordinates | 613480..613659 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965648.1 | Uniprot ID | A0AAD2WUQ9 |
| Organism | Streptococcus agalactiae isolate MRI Z2-299 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 573935..615688 | 613480..613659 | within | 0 |
| IScluster/Tn | 614343..615688 | 613480..613659 | flank | 684 |
Gene organization within MGE regions
Location: 573935..615688
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR61_RS03180 | - | 573953..574792 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| QOR61_RS03185 | - | 574767..575369 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| QOR61_RS03190 | - | 575472..575747 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| QOR61_RS03195 | - | 575835..576977 (-) | 1143 | WP_017646861.1 | site-specific integrase | - |
| QOR61_RS03200 | - | 577105..577314 (-) | 210 | WP_000442169.1 | TM2 domain-containing protein | - |
| QOR61_RS03205 | - | 577366..577746 (-) | 381 | WP_000700104.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QOR61_RS03210 | - | 577733..578074 (-) | 342 | WP_283572395.1 | helix-turn-helix transcriptional regulator | - |
| QOR61_RS03215 | - | 578273..578485 (+) | 213 | WP_000789121.1 | helix-turn-helix transcriptional regulator | - |
| QOR61_RS03220 | - | 578514..578846 (+) | 333 | WP_000158652.1 | hypothetical protein | - |
| QOR61_RS03225 | - | 578951..579286 (-) | 336 | WP_000360288.1 | hypothetical protein | - |
| QOR61_RS03230 | - | 579432..579617 (+) | 186 | WP_000263692.1 | helix-turn-helix transcriptional regulator | - |
| QOR61_RS03235 | - | 579696..580007 (+) | 312 | WP_001123481.1 | hypothetical protein | - |
| QOR61_RS03240 | - | 580012..580161 (+) | 150 | WP_000732607.1 | hypothetical protein | - |
| QOR61_RS03245 | - | 580237..580437 (+) | 201 | WP_001058281.1 | hypothetical protein | - |
| QOR61_RS03250 | - | 580434..580724 (+) | 291 | WP_000650503.1 | hypothetical protein | - |
| QOR61_RS03255 | - | 580711..581394 (+) | 684 | WP_000704951.1 | AAA family ATPase | - |
| QOR61_RS03265 | - | 581400..582833 (+) | 1434 | Protein_558 | DEAD/DEAH box helicase | - |
| QOR61_RS03270 | - | 582838..583320 (+) | 483 | WP_243081198.1 | DUF669 domain-containing protein | - |
| QOR61_RS03275 | - | 583338..584891 (+) | 1554 | WP_283572396.1 | phage resistance protein | - |
| QOR61_RS03280 | - | 585137..586003 (+) | 867 | WP_283572397.1 | bifunctional DNA primase/polymerase | - |
| QOR61_RS03285 | - | 585963..586313 (+) | 351 | WP_283572398.1 | VRR-NUC domain-containing protein | - |
| QOR61_RS03290 | - | 586392..586688 (+) | 297 | WP_283572399.1 | nucleotide modification associated domain-containing protein | - |
| QOR61_RS03295 | - | 586672..586830 (+) | 159 | WP_017647865.1 | hypothetical protein | - |
| QOR61_RS03300 | - | 586998..587489 (+) | 492 | WP_283572400.1 | hypothetical protein | - |
| QOR61_RS03305 | - | 587493..588008 (+) | 516 | WP_283572401.1 | DUF1642 domain-containing protein | - |
| QOR61_RS03310 | - | 588585..589010 (+) | 426 | WP_000533369.1 | DUF1492 domain-containing protein | - |
| QOR61_RS03320 | - | 589655..590032 (+) | 378 | WP_069986158.1 | HNH endonuclease signature motif containing protein | - |
| QOR61_RS03325 | - | 590183..590539 (+) | 357 | WP_000725958.1 | hypothetical protein | - |
| QOR61_RS03330 | - | 590536..591804 (+) | 1269 | WP_001108673.1 | phage portal protein | - |
| QOR61_RS03335 | - | 591797..593017 (+) | 1221 | WP_000227335.1 | polymorphic toxin type 50 domain-containing protein | - |
| QOR61_RS03340 | - | 593017..593205 (+) | 189 | WP_000421991.1 | hypothetical protein | - |
| QOR61_RS03345 | - | 593313..594728 (+) | 1416 | WP_000256854.1 | terminase large subunit | - |
| QOR61_RS03350 | - | 594809..595273 (+) | 465 | WP_001288696.1 | DUF4355 domain-containing protein | - |
| QOR61_RS03355 | - | 595276..596178 (+) | 903 | WP_000841024.1 | phage major capsid protein | - |
| QOR61_RS03360 | - | 596175..596390 (+) | 216 | WP_000640308.1 | hypothetical protein | - |
| QOR61_RS03365 | - | 596404..596835 (+) | 432 | WP_000180799.1 | phage Gp19/Gp15/Gp42 family protein | - |
| QOR61_RS03370 | - | 596786..597124 (+) | 339 | WP_001096306.1 | hypothetical protein | - |
| QOR61_RS03375 | - | 597117..597353 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| QOR61_RS03380 | - | 597354..597689 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| QOR61_RS03385 | - | 597699..598256 (+) | 558 | WP_283572402.1 | phage tail protein | - |
| QOR61_RS03390 | - | 598256..598501 (+) | 246 | WP_000448691.1 | hypothetical protein | - |
| QOR61_RS03395 | - | 598516..598890 (+) | 375 | WP_000909906.1 | DUF5361 domain-containing protein | - |
| QOR61_RS03400 | - | 598890..600902 (+) | 2013 | WP_283572403.1 | PblA | - |
| QOR61_RS03405 | - | 600896..602416 (+) | 1521 | WP_283572404.1 | distal tail protein Dit | - |
| QOR61_RS03410 | - | 602417..606229 (+) | 3813 | WP_283572405.1 | glucosaminidase domain-containing protein | - |
| QOR61_RS03415 | - | 606230..608221 (+) | 1992 | WP_283572406.1 | DUF859 family phage minor structural protein | - |
| QOR61_RS03420 | - | 608233..608625 (+) | 393 | WP_283572407.1 | DUF1366 domain-containing protein | - |
| QOR61_RS03425 | - | 608648..608776 (+) | 129 | WP_283572408.1 | hypothetical protein | - |
| QOR61_RS03430 | - | 608785..609087 (+) | 303 | WP_001018078.1 | hypothetical protein | - |
| QOR61_RS03435 | - | 609080..609307 (+) | 228 | WP_000609114.1 | phage holin | - |
| QOR61_RS03440 | - | 609435..610778 (+) | 1344 | WP_255895492.1 | GH25 family lysozyme | - |
| QOR61_RS03445 | - | 611030..611452 (+) | 423 | WP_000061484.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| QOR61_RS03450 | - | 611449..612495 (+) | 1047 | WP_001255838.1 | hypothetical protein | - |
| QOR61_RS03455 | - | 612653..612853 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| QOR61_RS03460 | - | 612895..613065 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| QOR61_RS03465 | - | 613201..613326 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| QOR61_RS03470 | prx | 613480..613659 (+) | 180 | WP_000965648.1 | hypothetical protein | Regulator |
| QOR61_RS03475 | - | 614065..614262 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| QOR61_RS03480 | - | 614343..615688 (+) | 1346 | WP_167513700.1 | IS3-like element IS861 family transposase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6972.99 Da Isoelectric Point: 4.4488
>NTDB_id=1159306 QOR61_RS03470 WP_000965648.1 613480..613659(+) (prx) [Streptococcus agalactiae isolate MRI Z2-299]
MLYIDEFKEAIDRGYIMGSTVAIVRKNGKIFDYVLPHEKVRDDETVTIERVEEVLRELE
MLYIDEFKEAIDRGYIMGSTVAIVRKNGKIFDYVLPHEKVRDDETVTIERVEEVLRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1159306 QOR61_RS03470 WP_000965648.1 613480..613659(+) (prx) [Streptococcus agalactiae isolate MRI Z2-299]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAGAGGATATATTATGGGAAGCACAGTTGCGATCGTACGAAAAAA
TGGAAAGATATTCGATTACGTTTTGCCACACGAAAAAGTTAGAGATGATGAAACTGTGACGATTGAGAGAGTAGAAGAAG
TGTTGAGGGAATTGGAGTAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAGAGGATATATTATGGGAAGCACAGTTGCGATCGTACGAAAAAA
TGGAAAGATATTCGATTACGTTTTGCCACACGAAAAAGTTAGAGATGATGAAACTGTGACGATTGAGAGAGTAGAAGAAG
TGTTGAGGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
72.881 |
100 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
100 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
72.881 |
0.678 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
69.492 |
0.559 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
71.186 |
0.525 |