Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | QOR44_RS03020 | Genome accession | NZ_OX460931 |
| Coordinates | 546902..547090 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae isolate MRI Z2-174 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 538155..546860 | 546902..547090 | flank | 42 |
| IS/Tn | 545856..546467 | 546902..547090 | flank | 435 |
Gene organization within MGE regions
Location: 538155..547090
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR44_RS02980 | - | 539534..539695 (-) | 162 | WP_000508795.1 | NINE protein | - |
| QOR44_RS02985 | - | 540437..541714 (+) | 1278 | WP_000594367.1 | ABC transporter permease | - |
| QOR44_RS02990 | - | 541724..542380 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| QOR44_RS02995 | - | 542380..543756 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| QOR44_RS03000 | - | 543853..544506 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| QOR44_RS03005 | - | 544503..545804 (+) | 1302 | WP_000734168.1 | HAMP domain-containing sensor histidine kinase | - |
| QOR44_RS03010 | - | 545856..546503 (-) | 648 | Protein_508 | IS3 family transposase | - |
| QOR44_RS03015 | - | 546681..546860 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| QOR44_RS03020 | prx | 546902..547090 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=1158872 QOR44_RS03020 WP_000027835.1 546902..547090(+) (prx) [Streptococcus agalactiae isolate MRI Z2-174]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=1158872 QOR44_RS03020 WP_000027835.1 546902..547090(+) (prx) [Streptococcus agalactiae isolate MRI Z2-174]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |