Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | W903_RS10315 | Genome accession | NZ_CP006910 |
| Coordinates | 641057..641245 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae CNCTC 10/84 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 632270..641015 | 641057..641245 | flank | 42 |
| IS/Tn | 639990..640601 | 641057..641245 | flank | 456 |
Gene organization within MGE regions
Location: 632270..641245
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| W903_RS10310 (W903_0724) | - | 633649..633810 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| W903_RS03535 (W903_0725) | - | 634553..635830 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| W903_RS03540 (W903_0726) | - | 635840..636496 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| W903_RS03545 (W903_0727) | - | 636496..637872 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| W903_RS03550 (W903_0728) | - | 637969..638622 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| W903_RS03555 (W903_0729) | - | 638619..639938 (+) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| W903_RS03560 (W903_0730) | - | 639990..640637 (-) | 648 | Protein_627 | IS3 family transposase | - |
| W903_RS03565 (W903_0731) | - | 640815..641015 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| W903_RS10315 (W903_0732) | prx | 641057..641245 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=114970 W903_RS10315 WP_000027835.1 641057..641245(+) (prx) [Streptococcus agalactiae CNCTC 10/84]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=114970 W903_RS10315 WP_000027835.1 641057..641245(+) (prx) [Streptococcus agalactiae CNCTC 10/84]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |