Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DXE30_RS05170 | Genome accession | NZ_LT992466 |
| Coordinates | 1029168..1029638 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus isolate 4_LA_208 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1007102..1058558 | 1029168..1029638 | within | 0 |
Gene organization within MGE regions
Location: 1007102..1058558
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE30_RS05010 | groES | 1007102..1007386 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| DXE30_RS05015 | groL | 1007462..1009078 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| DXE30_RS05020 | - | 1009619..1009798 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| DXE30_RS14300 | - | 1009795..1010421 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| DXE30_RS05040 | - | 1010960..1012267 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| DXE30_RS05050 | - | 1012650..1013873 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| DXE30_RS05055 | - | 1014305..1015360 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| DXE30_RS05060 | - | 1015382..1016398 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| DXE30_RS05065 | sph | 1016660..1017484 (-) | 825 | Protein_957 | sphingomyelin phosphodiesterase | - |
| DXE30_RS05070 | - | 1017541..1018578 (-) | 1038 | WP_000857198.1 | tyrosine-type recombinase/integrase | - |
| DXE30_RS05075 | - | 1018771..1019475 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DXE30_RS05080 | - | 1019615..1019782 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| DXE30_RS05085 | - | 1019982..1020167 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| DXE30_RS14305 | - | 1020154..1020309 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| DXE30_RS05090 | - | 1020321..1021052 (-) | 732 | WP_001566740.1 | XRE family transcriptional regulator | - |
| DXE30_RS05095 | - | 1021204..1021416 (+) | 213 | WP_000213811.1 | helix-turn-helix transcriptional regulator | - |
| DXE30_RS05100 | - | 1021464..1021724 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| DXE30_RS05105 | - | 1021748..1022287 (-) | 540 | WP_061385157.1 | hypothetical protein | - |
| DXE30_RS05110 | - | 1022344..1023093 (+) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| DXE30_RS05115 | - | 1023109..1023306 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| DXE30_RS05120 | - | 1023337..1023477 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| DXE30_RS05125 | - | 1023492..1024124 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| DXE30_RS05130 | - | 1024183..1024503 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| DXE30_RS05135 | - | 1024500..1024661 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| DXE30_RS05140 | - | 1024756..1025082 (+) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| DXE30_RS05145 | - | 1025063..1025323 (+) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| DXE30_RS05150 | - | 1025332..1025595 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| DXE30_RS05155 | - | 1025604..1027547 (+) | 1944 | WP_061736933.1 | AAA family ATPase | - |
| DXE30_RS05160 | - | 1027549..1028469 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| DXE30_RS05165 | - | 1028550..1029167 (+) | 618 | WP_078158007.1 | MBL fold metallo-hydrolase | - |
| DXE30_RS05170 | ssbA | 1029168..1029638 (+) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| DXE30_RS05175 | - | 1029668..1030552 (+) | 885 | WP_031833239.1 | DnaD domain protein | - |
| DXE30_RS05180 | - | 1030559..1030777 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| DXE30_RS05185 | - | 1030786..1031190 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DXE30_RS05190 | - | 1031203..1031571 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| DXE30_RS05195 | - | 1031575..1031817 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| DXE30_RS05200 | - | 1031832..1032080 (+) | 249 | WP_061385154.1 | DUF1024 family protein | - |
| DXE30_RS05205 | - | 1032073..1032606 (+) | 534 | WP_061385153.1 | dUTP diphosphatase | - |
| DXE30_RS05210 | - | 1032643..1032849 (+) | 207 | WP_061385152.1 | DUF1381 domain-containing protein | - |
| DXE30_RS05215 | - | 1032846..1033232 (+) | 387 | WP_061385151.1 | hypothetical protein | - |
| DXE30_RS05220 | rinB | 1033229..1033378 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| DXE30_RS05225 | - | 1033537..1034187 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| DXE30_RS05230 | - | 1034187..1034387 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| DXE30_RS05235 | - | 1034415..1034831 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| DXE30_RS05240 | - | 1035063..1035362 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| DXE30_RS05245 | - | 1035492..1035836 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| DXE30_RS05250 | - | 1035833..1037494 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| DXE30_RS05255 | - | 1037510..1038697 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| DXE30_RS05260 | - | 1038681..1039418 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| DXE30_RS05265 | - | 1039442..1040587 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| DXE30_RS05270 | - | 1040607..1040891 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| DXE30_RS05275 | - | 1040881..1041165 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DXE30_RS05280 | - | 1041149..1041511 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DXE30_RS05285 | - | 1041508..1041912 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| DXE30_RS05290 | - | 1041909..1042316 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| DXE30_RS05295 | - | 1042317..1042961 (+) | 645 | WP_000268740.1 | major tail protein | - |
| DXE30_RS05300 | - | 1042997..1043227 (+) | 231 | Protein_1005 | Ig-like domain-containing protein | - |
| DXE30_RS05305 | gpG | 1043277..1043627 (+) | 351 | WP_001096353.1 | phage tail assembly chaperone G | - |
| DXE30_RS14530 | gpGT | 1043678..1043815 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DXE30_RS05310 | - | 1043872..1048401 (+) | 4530 | WP_114638088.1 | phage tail tape measure protein | - |
| DXE30_RS05315 | - | 1048398..1049882 (+) | 1485 | WP_031889406.1 | phage distal tail protein | - |
| DXE30_RS05320 | - | 1049898..1053683 (+) | 3786 | WP_098827734.1 | phage tail spike protein | - |
| DXE30_RS05325 | - | 1053673..1053825 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE30_RS05330 | - | 1053872..1054159 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE30_RS05335 | - | 1054217..1054513 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE30_RS05340 | pepG1 | 1054705..1054839 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DXE30_RS05345 | - | 1054892..1054999 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE30_RS05350 | - | 1055051..1055305 (+) | 255 | WP_000611512.1 | phage holin | - |
| DXE30_RS05355 | - | 1055317..1056072 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE30_RS05360 | sak | 1056263..1056754 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| DXE30_RS05370 | - | 1057356..1057697 (+) | 342 | Protein_1019 | SH3 domain-containing protein | - |
| DXE30_RS05375 | scn | 1058208..1058558 (+) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=1149629 DXE30_RS05170 WP_000934764.1 1029168..1029638(+) (ssbA) [Staphylococcus aureus isolate 4_LA_208]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1149629 DXE30_RS05170 WP_000934764.1 1029168..1029638(+) (ssbA) [Staphylococcus aureus isolate 4_LA_208]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |