Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | W903_RS03325 | Genome accession | NZ_CP006910 |
| Coordinates | 591191..591370 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae CNCTC 10/84 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 548885..592949 | 591191..591370 | within | 0 |
Gene organization within MGE regions
Location: 548885..592949
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| W903_RS03045 (W903_0624) | - | 548903..549742 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| W903_RS03050 (W903_0625) | - | 549717..550319 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| W903_RS03055 (W903_0626) | - | 550422..550697 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| W903_RS03060 (W903_0627) | - | 550785..551927 (-) | 1143 | WP_000269474.1 | site-specific integrase | - |
| W903_RS03065 (W903_0628) | - | 552042..552593 (-) | 552 | WP_000353929.1 | hypothetical protein | - |
| W903_RS03070 (W903_0629) | - | 552611..552997 (-) | 387 | WP_000151183.1 | ImmA/IrrE family metallo-endopeptidase | - |
| W903_RS03075 (W903_0630) | - | 553001..553348 (-) | 348 | WP_000493080.1 | helix-turn-helix domain-containing protein | - |
| W903_RS03080 (W903_0631) | - | 553645..553890 (+) | 246 | WP_000739595.1 | hypothetical protein | - |
| W903_RS03085 (W903_0632) | - | 553841..554629 (-) | 789 | WP_000092751.1 | hypothetical protein | - |
| W903_RS03090 (W903_0633) | - | 554680..554871 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| W903_RS03095 (W903_0634) | - | 554951..555262 (+) | 312 | WP_001123483.1 | hypothetical protein | - |
| W903_RS10765 (W903_0635) | - | 555267..555416 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| W903_RS03100 (W903_0636) | - | 555410..555637 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| W903_RS03105 (W903_0637) | - | 555630..555860 (+) | 231 | WP_000573548.1 | hypothetical protein | - |
| W903_RS03110 (W903_0638) | - | 555844..557163 (+) | 1320 | WP_000156423.1 | AAA family ATPase | - |
| W903_RS03115 (W903_0639) | - | 557178..558272 (+) | 1095 | WP_001167562.1 | ATP-binding protein | - |
| W903_RS03120 (W903_0640) | - | 558312..558734 (+) | 423 | WP_000361801.1 | hypothetical protein | - |
| W903_RS03125 (W903_0641) | - | 558736..559470 (+) | 735 | WP_001293486.1 | hypothetical protein | - |
| W903_RS03130 (W903_0642) | - | 559491..560096 (+) | 606 | WP_038406062.1 | hypothetical protein | - |
| W903_RS03135 (W903_0643) | - | 560096..560704 (+) | 609 | WP_001876771.1 | hypothetical protein | - |
| W903_RS03140 (W903_0644) | - | 560710..562293 (+) | 1584 | WP_032457631.1 | DEAD/DEAH box helicase | - |
| W903_RS03145 (W903_0645) | - | 562302..562499 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| W903_RS03150 (W903_0646) | - | 562492..562743 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| W903_RS03155 (W903_0647) | - | 562814..565093 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| W903_RS03160 (W903_0648) | - | 565455..565673 (+) | 219 | WP_000388746.1 | crAss001_48 related protein | - |
| W903_RS03165 (W903_0649) | - | 565666..566061 (+) | 396 | WP_000569002.1 | RusA family crossover junction endodeoxyribonuclease | - |
| W903_RS03170 (W903_0650) | - | 566058..566273 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| W903_RS03175 (W903_0651) | - | 566270..566506 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| W903_RS10855 | - | 566503..566736 (+) | 234 | WP_001005354.1 | hypothetical protein | - |
| W903_RS03185 (W903_0652) | - | 566813..567226 (+) | 414 | WP_000041037.1 | transcriptional regulator | - |
| W903_RS03190 (W903_0653) | - | 567401..568153 (+) | 753 | WP_001075092.1 | toll/interleukin-1 receptor domain-containing protein | - |
| W903_RS03195 (W903_0654) | - | 568207..568638 (+) | 432 | WP_038406064.1 | terminase small subunit | - |
| W903_RS03200 (W903_0655) | - | 568628..569908 (+) | 1281 | WP_000208744.1 | PBSX family phage terminase large subunit | - |
| W903_RS03205 (W903_0656) | - | 569986..571452 (+) | 1467 | WP_374188409.1 | phage portal protein | - |
| W903_RS03210 (W903_0657) | - | 571412..572860 (+) | 1449 | WP_032457629.1 | phage head morphogenesis protein | - |
| W903_RS10975 | - | 572888..573076 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| W903_RS03220 (W903_0659) | - | 573081..573284 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| W903_RS03225 (W903_0660) | - | 573427..573996 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| W903_RS10740 (W903_0661) | - | 574015..574911 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| W903_RS03235 (W903_0662) | - | 574917..575273 (+) | 357 | WP_000356704.1 | phage head-tail connector protein | - |
| W903_RS03240 (W903_0663) | - | 575284..575562 (+) | 279 | WP_000639436.1 | hypothetical protein | - |
| W903_RS03245 (W903_0664) | - | 575559..575903 (+) | 345 | WP_000060407.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| W903_RS03250 (W903_0665) | - | 575911..576270 (+) | 360 | WP_000331817.1 | hypothetical protein | - |
| W903_RS03255 (W903_0666) | - | 576282..576914 (+) | 633 | WP_000450518.1 | phage major tail protein, TP901-1 family | - |
| W903_RS03260 (W903_0667) | - | 576965..577420 (+) | 456 | WP_000424191.1 | tail assembly chaperone | - |
| W903_RS03265 (W903_0668) | - | 577495..577725 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| W903_RS03270 (W903_0669) | - | 577754..581980 (+) | 4227 | WP_000929199.1 | tape measure protein | - |
| W903_RS03275 (W903_0670) | - | 581993..582835 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| W903_RS10860 (W903_0671) | - | 582848..584356 (+) | 1509 | WP_235301398.1 | phage tail protein | - |
| W903_RS10865 (W903_0672) | - | 584404..586674 (+) | 2271 | WP_038406065.1 | gp58-like family protein | - |
| W903_RS10770 (W903_0673) | - | 586683..586835 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| W903_RS03290 (W903_0674) | - | 586846..587262 (+) | 417 | WP_001870768.1 | DUF1366 domain-containing protein | - |
| W903_RS10775 (W903_0675) | - | 587325..587486 (+) | 162 | WP_000222555.1 | hypothetical protein | - |
| W903_RS03295 (W903_0676) | - | 587496..587786 (+) | 291 | WP_000564986.1 | hypothetical protein | - |
| W903_RS03300 (W903_0677) | - | 587788..588039 (+) | 252 | WP_000611525.1 | phage holin | - |
| W903_RS03310 (W903_0678) | - | 588159..589352 (+) | 1194 | WP_000143381.1 | glucosaminidase domain-containing protein | - |
| W903_RS03315 (W903_0679) | - | 589718..590233 (+) | 516 | WP_000837684.1 | hypothetical protein | - |
| W903_RS03320 (W903_0680) | - | 590360..590560 (+) | 201 | WP_000076712.1 | CsbD family protein | - |
| W903_RS10780 (W903_0681) | - | 590601..590771 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| W903_RS10950 | - | 590907..591032 (-) | 126 | WP_017646884.1 | hypothetical protein | - |
| W903_RS03325 (W903_0682) | prx | 591191..591370 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| W903_RS03330 (W903_0683) | - | 591776..591973 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| W903_RS03335 (W903_0684) | - | 592017..592949 (-) | 933 | WP_000254064.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=114940 W903_RS03325 WP_000965651.1 591191..591370(+) (prx) [Streptococcus agalactiae CNCTC 10/84]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=114940 W903_RS03325 WP_000965651.1 591191..591370(+) (prx) [Streptococcus agalactiae CNCTC 10/84]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |