Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BQ8897_RS09055 | Genome accession | NZ_LT714196 |
| Coordinates | 1724629..1724784 (-) | Length | 51 a.a. |
| NCBI ID | WP_041330050.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae isolate BM110 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1714427..1761661 | 1724629..1724784 | within | 0 |
Gene organization within MGE regions
Location: 1714427..1761661
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ8897_RS09010 (BQ8897_BM110_01764) | cydC | 1714427..1716175 (-) | 1749 | WP_000472826.1 | thiol reductant ABC exporter subunit CydC | - |
| BQ8897_RS09015 (BQ8897_BM110_01765) | cydD | 1716168..1717886 (-) | 1719 | WP_000884542.1 | thiol reductant ABC exporter subunit CydD | - |
| BQ8897_RS09020 (BQ8897_BM110_01766) | cydB | 1717886..1718905 (-) | 1020 | WP_001275291.1 | cytochrome d ubiquinol oxidase subunit II | - |
| BQ8897_RS09025 (BQ8897_BM110_01767) | - | 1718906..1720333 (-) | 1428 | WP_000151500.1 | cytochrome ubiquinol oxidase subunit I | - |
| BQ8897_RS09030 (BQ8897_BM110_01768) | - | 1720436..1721644 (-) | 1209 | WP_000659003.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| BQ8897_RS09035 (BQ8897_BM110_01769) | - | 1721657..1722556 (-) | 900 | WP_000174552.1 | prenyltransferase | - |
| BQ8897_RS09040 (BQ8897_BM110_01770) | - | 1722965..1723570 (-) | 606 | WP_001037495.1 | hypothetical protein | - |
| BQ8897_RS09055 (BQ8897_BM110_01771) | prx | 1724629..1724784 (-) | 156 | WP_041330050.1 | hypothetical protein | Regulator |
| BQ8897_RS11895 (BQ8897_BM110_01772) | - | 1724941..1725066 (+) | 126 | WP_017285425.1 | hypothetical protein | - |
| BQ8897_RS09060 (BQ8897_BM110_01773) | - | 1725202..1725372 (+) | 171 | WP_000356856.1 | hypothetical protein | - |
| BQ8897_RS09065 (BQ8897_BM110_01774) | - | 1725634..1726965 (-) | 1332 | WP_086874289.1 | GH25 family lysozyme | - |
| BQ8897_RS09070 (BQ8897_BM110_01776) | - | 1727091..1727318 (-) | 228 | WP_000609115.1 | phage holin | - |
| BQ8897_RS09075 (BQ8897_BM110_01777) | - | 1727311..1727613 (-) | 303 | WP_001017826.1 | hypothetical protein | - |
| BQ8897_RS11900 | - | 1727622..1727750 (-) | 129 | WP_000973384.1 | hypothetical protein | - |
| BQ8897_RS09080 (BQ8897_BM110_01779) | - | 1727773..1728165 (-) | 393 | WP_000889195.1 | DUF1366 domain-containing protein | - |
| BQ8897_RS09085 (BQ8897_BM110_01780) | - | 1728177..1730180 (-) | 2004 | WP_000206875.1 | DUF859 family phage minor structural protein | - |
| BQ8897_RS09090 (BQ8897_BM110_01781) | - | 1730181..1734203 (-) | 4023 | WP_086874291.1 | glucosaminidase domain-containing protein | - |
| BQ8897_RS09095 (BQ8897_BM110_01782) | - | 1734204..1735736 (-) | 1533 | WP_086874293.1 | distal tail protein Dit | - |
| BQ8897_RS09100 (BQ8897_BM110_01783) | - | 1735730..1737742 (-) | 2013 | WP_086874295.1 | PblA | - |
| BQ8897_RS09105 (BQ8897_BM110_01784) | - | 1737742..1738116 (-) | 375 | WP_000909906.1 | DUF5361 domain-containing protein | - |
| BQ8897_RS09110 (BQ8897_BM110_01785) | - | 1738131..1738376 (-) | 246 | WP_000448691.1 | hypothetical protein | - |
| BQ8897_RS09115 (BQ8897_BM110_01786) | - | 1738376..1738933 (-) | 558 | WP_017643418.1 | hypothetical protein | - |
| BQ8897_RS09120 (BQ8897_BM110_01787) | - | 1738943..1739278 (-) | 336 | WP_017767442.1 | hypothetical protein | - |
| BQ8897_RS09125 (BQ8897_BM110_01788) | - | 1739278..1739514 (-) | 237 | WP_086874297.1 | hypothetical protein | - |
| BQ8897_RS09130 (BQ8897_BM110_01789) | - | 1739507..1739845 (-) | 339 | WP_017643415.1 | hypothetical protein | - |
| BQ8897_RS09135 (BQ8897_BM110_01790) | - | 1739796..1740227 (-) | 432 | WP_017643414.1 | phage Gp19/Gp15/Gp42 family protein | - |
| BQ8897_RS09140 (BQ8897_BM110_01791) | - | 1740238..1740453 (-) | 216 | WP_017643413.1 | hypothetical protein | - |
| BQ8897_RS09145 (BQ8897_BM110_01792) | - | 1740450..1741358 (-) | 909 | WP_086874299.1 | phage major capsid protein | - |
| BQ8897_RS09150 (BQ8897_BM110_01793) | - | 1741362..1741826 (-) | 465 | WP_017643411.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| BQ8897_RS09155 (BQ8897_BM110_01794) | - | 1741908..1743320 (-) | 1413 | WP_017644153.1 | terminase | - |
| BQ8897_RS09160 (BQ8897_BM110_01796) | - | 1743509..1744198 (-) | 690 | WP_086874301.1 | hypothetical protein | - |
| BQ8897_RS09165 (BQ8897_BM110_01797) | - | 1744191..1745432 (-) | 1242 | WP_017643407.1 | hypothetical protein | - |
| BQ8897_RS09170 (BQ8897_BM110_01798) | - | 1745429..1745785 (-) | 357 | WP_017643406.1 | hypothetical protein | - |
| BQ8897_RS09175 (BQ8897_BM110_01799) | - | 1745933..1746277 (-) | 345 | WP_017643767.1 | HNH endonuclease signature motif containing protein | - |
| BQ8897_RS09180 (BQ8897_BM110_01800) | - | 1746518..1746943 (-) | 426 | WP_172838659.1 | DUF1492 domain-containing protein | - |
| BQ8897_RS09185 (BQ8897_BM110_01801) | - | 1747330..1747596 (-) | 267 | WP_000660742.1 | hypothetical protein | - |
| BQ8897_RS09190 (BQ8897_BM110_01802) | - | 1747593..1748102 (-) | 510 | WP_001019144.1 | DUF1642 domain-containing protein | - |
| BQ8897_RS11670 (BQ8897_BM110_01803) | - | 1748117..1748281 (-) | 165 | WP_000864960.1 | hypothetical protein | - |
| BQ8897_RS11675 (BQ8897_BM110_01804) | - | 1748271..1748435 (-) | 165 | WP_017645326.1 | hypothetical protein | - |
| BQ8897_RS09195 (BQ8897_BM110_01805) | - | 1748437..1748760 (-) | 324 | WP_000052300.1 | hypothetical protein | - |
| BQ8897_RS09200 (BQ8897_BM110_01806) | - | 1748763..1749248 (-) | 486 | WP_017648349.1 | class I SAM-dependent methyltransferase | - |
| BQ8897_RS09205 (BQ8897_BM110_01807) | - | 1749251..1749520 (-) | 270 | WP_086874303.1 | hypothetical protein | - |
| BQ8897_RS09210 (BQ8897_BM110_01808) | - | 1749603..1749860 (-) | 258 | WP_086874305.1 | DUF3850 domain-containing protein | - |
| BQ8897_RS09215 (BQ8897_BM110_01809) | - | 1749975..1750388 (-) | 414 | WP_086874307.1 | YopX family protein | - |
| BQ8897_RS09225 (BQ8897_BM110_01811) | - | 1750513..1750824 (-) | 312 | WP_047198905.1 | nucleotide modification associated domain-containing protein | - |
| BQ8897_RS09230 (BQ8897_BM110_01812) | - | 1750836..1751180 (-) | 345 | WP_017643764.1 | hypothetical protein | - |
| BQ8897_RS09235 (BQ8897_BM110_01813) | - | 1751161..1751649 (-) | 489 | WP_086874311.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BQ8897_RS09240 (BQ8897_BM110_01814) | - | 1751639..1751836 (-) | 198 | WP_025196275.1 | hypothetical protein | - |
| BQ8897_RS09245 (BQ8897_BM110_01815) | - | 1752001..1752798 (-) | 798 | WP_086874313.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| BQ8897_RS09250 (BQ8897_BM110_01816) | - | 1752795..1753790 (-) | 996 | WP_086874315.1 | recombinase RecT | - |
| BQ8897_RS09255 (BQ8897_BM110_01817) | - | 1753853..1754107 (-) | 255 | WP_000229421.1 | hypothetical protein | - |
| BQ8897_RS09260 (BQ8897_BM110_01818) | - | 1754094..1754369 (-) | 276 | WP_000431579.1 | hypothetical protein | - |
| BQ8897_RS11680 | - | 1754359..1754505 (-) | 147 | WP_172838660.1 | hypothetical protein | - |
| BQ8897_RS09265 (BQ8897_BM110_01819) | - | 1754496..1755278 (-) | 783 | WP_050198765.1 | ATP-binding protein | - |
| BQ8897_RS09270 (BQ8897_BM110_01820) | - | 1755265..1756068 (-) | 804 | WP_172838663.1 | replication initiator protein A | - |
| BQ8897_RS11685 (BQ8897_BM110_01821) | - | 1756097..1756243 (-) | 147 | WP_000732676.1 | hypothetical protein | - |
| BQ8897_RS09275 (BQ8897_BM110_01822) | - | 1756240..1756497 (-) | 258 | WP_000454601.1 | hypothetical protein | - |
| BQ8897_RS11835 | - | 1756571..1756681 (-) | 111 | Protein_1732 | XRE family transcriptional regulator | - |
| BQ8897_RS11690 (BQ8897_BM110_01823) | - | 1756754..1756930 (+) | 177 | WP_016480515.1 | hypothetical protein | - |
| BQ8897_RS09280 (BQ8897_BM110_01824) | - | 1756958..1757146 (-) | 189 | WP_000724352.1 | hypothetical protein | - |
| BQ8897_RS09285 (BQ8897_BM110_01825) | - | 1757159..1757668 (-) | 510 | WP_041330062.1 | ORF6C domain-containing protein | - |
| BQ8897_RS09290 (BQ8897_BM110_01826) | - | 1757661..1758572 (-) | 912 | WP_086874319.1 | DUF3102 domain-containing protein | - |
| BQ8897_RS09295 (BQ8897_BM110_01827) | - | 1758601..1758813 (-) | 213 | WP_000789121.1 | helix-turn-helix transcriptional regulator | - |
| BQ8897_RS09300 (BQ8897_BM110_01828) | - | 1759010..1759351 (+) | 342 | WP_001002980.1 | helix-turn-helix domain-containing protein | - |
| BQ8897_RS09305 (BQ8897_BM110_01829) | - | 1759338..1759718 (+) | 381 | WP_000700105.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BQ8897_RS09310 (BQ8897_BM110_01830) | - | 1759770..1760396 (+) | 627 | WP_000438040.1 | TrbC/VirB2 family protein | - |
| BQ8897_RS09315 (BQ8897_BM110_01831) | - | 1760525..1761661 (+) | 1137 | WP_000264630.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 51 a.a. Molecular weight: 5814.65 Da Isoelectric Point: 4.6286
>NTDB_id=1146175 BQ8897_RS09055 WP_041330050.1 1724629..1724784(-) (prx) [Streptococcus agalactiae isolate BM110]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPHEKVRDDEVVAVESV
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPHEKVRDDEVVAVESV
Nucleotide
Download Length: 156 bp
>NTDB_id=1146175 BQ8897_RS09055 WP_041330050.1 1724629..1724784(-) (prx) [Streptococcus agalactiae isolate BM110]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGGCAGTAGAGAGTGTGTAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGGCAGTAGAGAGTGTGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
95.349 |
84.314 |
0.804 |
| prx | Streptococcus pyogenes MGAS8232 |
72.549 |
100 |
0.725 |
| prx | Streptococcus pyogenes MGAS315 |
70.588 |
100 |
0.706 |
| prx | Streptococcus pyogenes MGAS315 |
70.588 |
100 |
0.706 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
80.392 |
0.647 |
| prx | Streptococcus pyogenes MGAS315 |
64.706 |
100 |
0.647 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
82.353 |
0.608 |