Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BQ8897_RS03880 | Genome accession | NZ_LT714196 |
| Coordinates | 664255..664443 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae isolate BM110 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 655469..664213 | 664255..664443 | flank | 42 |
| IS/Tn | 663188..663799 | 664255..664443 | flank | 456 |
Gene organization within MGE regions
Location: 655469..664443
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ8897_RS03840 | - | 656848..657009 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| BQ8897_RS03845 (BQ8897_BM110_00744) | - | 657751..659028 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| BQ8897_RS03850 (BQ8897_BM110_00745) | - | 659038..659694 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| BQ8897_RS03855 (BQ8897_BM110_00746) | - | 659694..661070 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| BQ8897_RS03860 (BQ8897_BM110_00747) | - | 661167..661820 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| BQ8897_RS03865 (BQ8897_BM110_00748) | - | 661817..663136 (+) | 1320 | WP_000734167.1 | sensor histidine kinase | - |
| BQ8897_RS03870 (BQ8897_BM110_00749) | - | 663188..663835 (-) | 648 | Protein_675 | IS3 family transposase | - |
| BQ8897_RS03875 (BQ8897_BM110_00750) | - | 664013..664213 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| BQ8897_RS03880 | prx | 664255..664443 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=1146151 BQ8897_RS03880 WP_000027835.1 664255..664443(+) (prx) [Streptococcus agalactiae isolate BM110]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=1146151 BQ8897_RS03880 WP_000027835.1 664255..664443(+) (prx) [Streptococcus agalactiae isolate BM110]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |