Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BQ8897_RS03625 | Genome accession | NZ_LT714196 |
| Coordinates | 612938..613117 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae isolate BM110 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 572337..614696 | 612938..613117 | within | 0 |
Gene organization within MGE regions
Location: 572337..614696
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ8897_RS03360 (BQ8897_BM110_00642) | - | 572355..573194 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| BQ8897_RS03365 (BQ8897_BM110_00643) | - | 573169..573771 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| BQ8897_RS03370 (BQ8897_BM110_00644) | - | 573874..574149 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| BQ8897_RS03375 (BQ8897_BM110_00645) | - | 574237..575379 (-) | 1143 | WP_000269472.1 | tyrosine-type recombinase/integrase | - |
| BQ8897_RS03380 (BQ8897_BM110_00646) | - | 575494..576045 (-) | 552 | WP_000353930.1 | hypothetical protein | - |
| BQ8897_RS03385 (BQ8897_BM110_00647) | - | 576063..576449 (-) | 387 | WP_000151182.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BQ8897_RS03390 (BQ8897_BM110_00648) | - | 576453..576800 (-) | 348 | WP_000484457.1 | helix-turn-helix domain-containing protein | - |
| BQ8897_RS03395 (BQ8897_BM110_00649) | - | 577096..577341 (+) | 246 | WP_000739596.1 | hypothetical protein | - |
| BQ8897_RS03400 (BQ8897_BM110_00650) | - | 577292..578080 (-) | 789 | WP_000092750.1 | hypothetical protein | - |
| BQ8897_RS03405 (BQ8897_BM110_00651) | - | 578131..578322 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| BQ8897_RS03410 (BQ8897_BM110_00652) | - | 578402..578713 (+) | 312 | WP_001123482.1 | hypothetical protein | - |
| BQ8897_RS11640 (BQ8897_BM110_00653) | - | 578718..578867 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| BQ8897_RS03415 (BQ8897_BM110_00654) | - | 578861..579088 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| BQ8897_RS03420 (BQ8897_BM110_00655) | - | 579081..579311 (+) | 231 | WP_000573547.1 | hypothetical protein | - |
| BQ8897_RS03425 (BQ8897_BM110_00656) | - | 579295..580614 (+) | 1320 | WP_000156426.1 | AAA family ATPase | - |
| BQ8897_RS03430 (BQ8897_BM110_00657) | - | 580629..581702 (+) | 1074 | WP_001167564.1 | ATP-binding protein | - |
| BQ8897_RS03435 (BQ8897_BM110_00658) | - | 581798..582403 (+) | 606 | WP_000141564.1 | hypothetical protein | - |
| BQ8897_RS03440 (BQ8897_BM110_00659) | - | 582403..583011 (+) | 609 | WP_001870729.1 | hypothetical protein | - |
| BQ8897_RS03445 (BQ8897_BM110_00660) | - | 583017..584600 (+) | 1584 | WP_032456395.1 | DEAD/DEAH box helicase | - |
| BQ8897_RS03450 (BQ8897_BM110_00661) | - | 584609..584806 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| BQ8897_RS03455 (BQ8897_BM110_00662) | - | 584799..585050 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| BQ8897_RS03460 (BQ8897_BM110_00663) | - | 585121..587400 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| BQ8897_RS03465 (BQ8897_BM110_00664) | - | 587770..587967 (+) | 198 | WP_000666342.1 | crAss001_48 related protein | - |
| BQ8897_RS03470 (BQ8897_BM110_00665) | - | 587994..588392 (+) | 399 | WP_000151204.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BQ8897_RS03475 (BQ8897_BM110_00666) | - | 588389..588604 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| BQ8897_RS03480 (BQ8897_BM110_00667) | - | 588601..588837 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| BQ8897_RS03485 (BQ8897_BM110_00668) | - | 588834..589064 (+) | 231 | WP_001005355.1 | hypothetical protein | - |
| BQ8897_RS03490 (BQ8897_BM110_00669) | - | 589067..589399 (+) | 333 | WP_000052302.1 | hypothetical protein | - |
| BQ8897_RS03495 (BQ8897_BM110_00670) | - | 589477..589890 (+) | 414 | WP_000041038.1 | transcriptional regulator | - |
| BQ8897_RS03500 (BQ8897_BM110_00671) | - | 590011..590442 (+) | 432 | WP_000041103.1 | terminase small subunit | - |
| BQ8897_RS03505 (BQ8897_BM110_00672) | - | 590432..591712 (+) | 1281 | WP_000208745.1 | PBSX family phage terminase large subunit | - |
| BQ8897_RS03510 (BQ8897_BM110_00673) | - | 591790..593256 (+) | 1467 | WP_370657591.1 | phage portal protein | - |
| BQ8897_RS03515 (BQ8897_BM110_00674) | - | 593216..594664 (+) | 1449 | WP_032459253.1 | phage head morphogenesis protein | - |
| BQ8897_RS11920 | - | 594692..594880 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| BQ8897_RS03525 (BQ8897_BM110_00676) | - | 594885..595088 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| BQ8897_RS03530 (BQ8897_BM110_00677) | - | 595231..595800 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| BQ8897_RS11645 (BQ8897_BM110_00678) | - | 595819..596715 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| BQ8897_RS03540 (BQ8897_BM110_00679) | - | 596721..597077 (+) | 357 | WP_000356705.1 | phage head-tail connector protein | - |
| BQ8897_RS03545 (BQ8897_BM110_00680) | - | 597088..597366 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| BQ8897_RS03550 (BQ8897_BM110_00681) | - | 597363..597707 (+) | 345 | WP_000060408.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BQ8897_RS03555 (BQ8897_BM110_00682) | - | 597711..598070 (+) | 360 | WP_000640604.1 | hypothetical protein | - |
| BQ8897_RS03560 (BQ8897_BM110_00683) | - | 598082..598714 (+) | 633 | WP_000450517.1 | phage major tail protein, TP901-1 family | - |
| BQ8897_RS03565 (BQ8897_BM110_00684) | - | 598765..599220 (+) | 456 | WP_000424190.1 | tail assembly chaperone | - |
| BQ8897_RS03570 (BQ8897_BM110_00685) | - | 599295..599525 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| BQ8897_RS03575 (BQ8897_BM110_00686) | - | 599554..603780 (+) | 4227 | WP_000929196.1 | tape measure protein | - |
| BQ8897_RS03580 (BQ8897_BM110_00687) | - | 603793..604635 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| BQ8897_RS03585 (BQ8897_BM110_00688) | - | 604648..608475 (+) | 3828 | WP_000206522.1 | phage tail protein | - |
| BQ8897_RS11650 (BQ8897_BM110_00689) | - | 608484..608636 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| BQ8897_RS03590 (BQ8897_BM110_00690) | - | 608647..609063 (+) | 417 | WP_001873936.1 | DUF1366 domain-containing protein | - |
| BQ8897_RS11655 (BQ8897_BM110_00691) | - | 609126..609287 (+) | 162 | WP_000222556.1 | hypothetical protein | - |
| BQ8897_RS03595 (BQ8897_BM110_00692) | - | 609297..609593 (+) | 297 | WP_000564987.1 | hypothetical protein | - |
| BQ8897_RS03600 (BQ8897_BM110_00693) | - | 609595..609933 (+) | 339 | WP_001001962.1 | phage holin | - |
| BQ8897_RS03605 (BQ8897_BM110_00694) | - | 609935..610654 (+) | 720 | WP_000236382.1 | peptidoglycan amidohydrolase family protein | - |
| BQ8897_RS03610 (BQ8897_BM110_00695) | - | 610993..611952 (+) | 960 | WP_000829578.1 | Abi family protein | - |
| BQ8897_RS03615 (BQ8897_BM110_00696) | - | 612107..612307 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| BQ8897_RS03620 (BQ8897_BM110_00697) | - | 612348..612518 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| BQ8897_RS11870 (BQ8897_BM110_00698) | - | 612654..612779 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| BQ8897_RS03625 (BQ8897_BM110_00699) | prx | 612938..613117 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| BQ8897_RS03630 (BQ8897_BM110_00700) | - | 613523..613720 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| BQ8897_RS03635 (BQ8897_BM110_00701) | - | 613764..614696 (-) | 933 | WP_000254067.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=1146149 BQ8897_RS03625 WP_000965651.1 612938..613117(+) (prx) [Streptococcus agalactiae isolate BM110]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1146149 BQ8897_RS03625 WP_000965651.1 612938..613117(+) (prx) [Streptococcus agalactiae isolate BM110]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |