Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BQ8897_RS01045 | Genome accession | NZ_LT714196 |
| Coordinates | 146968..147150 (+) | Length | 60 a.a. |
| NCBI ID | WP_000965649.1 | Uniprot ID | A0AAV3JNR0 |
| Organism | Streptococcus agalactiae isolate BM110 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 102648..149376 | 146968..147150 | within | 0 |
Gene organization within MGE regions
Location: 102648..149376
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ8897_RS00725 (BQ8897_BM110_00132) | - | 102648..103745 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| BQ8897_RS00730 (BQ8897_BM110_00133) | - | 103918..104532 (-) | 615 | WP_000742866.1 | hypothetical protein | - |
| BQ8897_RS00740 (BQ8897_BM110_00134) | - | 104664..105443 (-) | 780 | WP_000095652.1 | S24 family peptidase | - |
| BQ8897_RS00745 (BQ8897_BM110_00136) | - | 105942..106154 (-) | 213 | WP_000703681.1 | hypothetical protein | - |
| BQ8897_RS00750 (BQ8897_BM110_00137) | - | 106213..106371 (+) | 159 | WP_001104143.1 | hypothetical protein | - |
| BQ8897_RS00755 (BQ8897_BM110_00138) | - | 106469..107110 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| BQ8897_RS00765 (BQ8897_BM110_00140) | - | 107327..107662 (-) | 336 | WP_000360289.1 | hypothetical protein | - |
| BQ8897_RS00770 (BQ8897_BM110_00141) | - | 107738..107944 (+) | 207 | WP_000164462.1 | helix-turn-helix transcriptional regulator | - |
| BQ8897_RS00775 (BQ8897_BM110_00142) | - | 107998..108957 (+) | 960 | WP_001156317.1 | hypothetical protein | - |
| BQ8897_RS00780 (BQ8897_BM110_00143) | - | 108950..109471 (+) | 522 | WP_000032137.1 | hypothetical protein | - |
| BQ8897_RS00785 (BQ8897_BM110_00144) | - | 109490..109681 (+) | 192 | WP_001003168.1 | hypothetical protein | - |
| BQ8897_RS11610 (BQ8897_BM110_00145) | - | 109709..109885 (-) | 177 | WP_017645150.1 | hypothetical protein | - |
| BQ8897_RS00790 | - | 110000..110176 (+) | 177 | WP_000728090.1 | helix-turn-helix domain-containing protein | - |
| BQ8897_RS00795 (BQ8897_BM110_00146) | - | 110255..110512 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| BQ8897_RS11860 (BQ8897_BM110_00147) | - | 110542..110673 (+) | 132 | WP_256948450.1 | hypothetical protein | - |
| BQ8897_RS11615 (BQ8897_BM110_00148) | - | 110810..110980 (+) | 171 | WP_000075411.1 | hypothetical protein | - |
| BQ8897_RS00800 (BQ8897_BM110_00149) | - | 111161..111433 (+) | 273 | WP_000370473.1 | hypothetical protein | - |
| BQ8897_RS00805 (BQ8897_BM110_00150) | - | 111423..111803 (-) | 381 | WP_025196029.1 | hypothetical protein | - |
| BQ8897_RS00810 (BQ8897_BM110_00151) | - | 111859..112302 (+) | 444 | WP_025196030.1 | hypothetical protein | - |
| BQ8897_RS00815 (BQ8897_BM110_00152) | - | 112418..113320 (+) | 903 | WP_025196031.1 | conserved phage C-terminal domain-containing protein | - |
| BQ8897_RS00820 (BQ8897_BM110_00153) | - | 113330..114172 (+) | 843 | WP_000863936.1 | ATP-binding protein | - |
| BQ8897_RS11620 (BQ8897_BM110_00154) | - | 114172..114318 (+) | 147 | WP_172838657.1 | hypothetical protein | - |
| BQ8897_RS00825 (BQ8897_BM110_00155) | - | 114308..114583 (+) | 276 | WP_000431575.1 | hypothetical protein | - |
| BQ8897_RS00830 (BQ8897_BM110_00156) | - | 114570..114824 (+) | 255 | WP_000229416.1 | hypothetical protein | - |
| BQ8897_RS00835 (BQ8897_BM110_00157) | - | 114827..114988 (+) | 162 | WP_001288192.1 | hypothetical protein | - |
| BQ8897_RS00840 (BQ8897_BM110_00158) | - | 114990..115319 (+) | 330 | WP_086874261.1 | hypothetical protein | - |
| BQ8897_RS00845 (BQ8897_BM110_00159) | - | 115322..116284 (+) | 963 | WP_086874262.1 | recombinase RecT | - |
| BQ8897_RS00850 (BQ8897_BM110_00160) | - | 116281..117078 (+) | 798 | WP_057485461.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| BQ8897_RS00855 (BQ8897_BM110_00161) | - | 117240..117437 (+) | 198 | WP_000239531.1 | hypothetical protein | - |
| BQ8897_RS00860 (BQ8897_BM110_00162) | - | 117427..117903 (+) | 477 | WP_050151484.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BQ8897_RS11730 | - | 117893..118241 (+) | 349 | Protein_122 | hypothetical protein | - |
| BQ8897_RS00870 (BQ8897_BM110_00163) | - | 118253..118549 (+) | 297 | WP_000763908.1 | nucleotide modification associated domain-containing protein | - |
| BQ8897_RS00875 (BQ8897_BM110_00164) | - | 118605..118772 (+) | 168 | WP_192827993.1 | hypothetical protein | - |
| BQ8897_RS00880 (BQ8897_BM110_00165) | - | 118803..118967 (+) | 165 | WP_000159368.1 | hypothetical protein | - |
| BQ8897_RS00885 (BQ8897_BM110_00166) | - | 118964..119233 (+) | 270 | WP_000139628.1 | hypothetical protein | - |
| BQ8897_RS11625 (BQ8897_BM110_00167) | - | 119237..119380 (+) | 144 | WP_000564605.1 | hypothetical protein | - |
| BQ8897_RS00890 (BQ8897_BM110_00168) | - | 119377..119889 (+) | 513 | WP_001019149.1 | DUF1642 domain-containing protein | - |
| BQ8897_RS00895 (BQ8897_BM110_00169) | - | 119910..120209 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| BQ8897_RS00900 (BQ8897_BM110_00171) | - | 120397..120591 (+) | 195 | WP_000221698.1 | hypothetical protein | - |
| BQ8897_RS00905 (BQ8897_BM110_00172) | - | 120588..120854 (+) | 267 | WP_000660738.1 | hypothetical protein | - |
| BQ8897_RS00910 (BQ8897_BM110_00173) | - | 121243..121677 (+) | 435 | WP_000142566.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BQ8897_RS11865 (BQ8897_BM110_00175) | - | 122233..122361 (+) | 129 | WP_017647279.1 | hypothetical protein | - |
| BQ8897_RS00920 (BQ8897_BM110_00176) | - | 122415..122792 (-) | 378 | WP_000964195.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| BQ8897_RS00925 (BQ8897_BM110_00177) | - | 122845..123030 (-) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| BQ8897_RS00930 (BQ8897_BM110_00178) | - | 123131..123466 (+) | 336 | WP_001247766.1 | HNH endonuclease | - |
| BQ8897_RS00935 (BQ8897_BM110_00179) | - | 123639..124106 (+) | 468 | WP_000532794.1 | phage terminase small subunit P27 family | - |
| BQ8897_RS00940 (BQ8897_BM110_00180) | - | 124121..125875 (+) | 1755 | WP_041981227.1 | terminase large subunit | - |
| BQ8897_RS11630 (BQ8897_BM110_00181) | - | 125872..126042 (+) | 171 | WP_165736994.1 | hypothetical protein | - |
| BQ8897_RS00945 (BQ8897_BM110_00182) | - | 126035..126238 (+) | 204 | WP_001042281.1 | hypothetical protein | - |
| BQ8897_RS00950 (BQ8897_BM110_00183) | - | 126269..127489 (+) | 1221 | WP_086874263.1 | phage portal protein | - |
| BQ8897_RS00955 (BQ8897_BM110_00184) | - | 127467..128132 (+) | 666 | WP_001124818.1 | head maturation protease, ClpP-related | - |
| BQ8897_RS00960 (BQ8897_BM110_00185) | - | 128156..129340 (+) | 1185 | WP_086874264.1 | phage major capsid protein | - |
| BQ8897_RS11635 | - | 129354..129515 (+) | 162 | WP_017285214.1 | hypothetical protein | - |
| BQ8897_RS00965 (BQ8897_BM110_00186) | - | 129518..129820 (+) | 303 | WP_000218656.1 | head-tail connector protein | - |
| BQ8897_RS00970 (BQ8897_BM110_00187) | - | 129817..130164 (+) | 348 | WP_086874265.1 | phage head closure protein | - |
| BQ8897_RS00975 (BQ8897_BM110_00188) | - | 130161..130538 (+) | 378 | WP_000160228.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BQ8897_RS00980 (BQ8897_BM110_00189) | - | 130535..130960 (+) | 426 | WP_000559944.1 | hypothetical protein | - |
| BQ8897_RS00985 (BQ8897_BM110_00190) | - | 130976..131599 (+) | 624 | WP_000521116.1 | major tail protein | - |
| BQ8897_RS00990 (BQ8897_BM110_00191) | gpG | 131653..131973 (+) | 321 | WP_000273027.1 | phage tail assembly chaperone G | - |
| BQ8897_RS11425 | - | 131997..132170 (+) | 174 | WP_000928086.1 | hypothetical protein | - |
| BQ8897_RS00995 (BQ8897_BM110_00192) | - | 132183..136124 (+) | 3942 | WP_041981230.1 | phage tail tape measure protein | - |
| BQ8897_RS01000 (BQ8897_BM110_00193) | - | 136121..137632 (+) | 1512 | WP_000668940.1 | distal tail protein Dit | - |
| BQ8897_RS01005 (BQ8897_BM110_00194) | - | 137623..141750 (+) | 4128 | WP_172838658.1 | glucosaminidase domain-containing protein | - |
| BQ8897_RS01010 (BQ8897_BM110_00195) | - | 141763..143754 (+) | 1992 | WP_086874266.1 | DUF859 family phage minor structural protein | - |
| BQ8897_RS01015 (BQ8897_BM110_00196) | - | 143768..144094 (+) | 327 | WP_025196065.1 | DUF1366 domain-containing protein | - |
| BQ8897_RS01020 (BQ8897_BM110_00197) | - | 144123..144281 (+) | 159 | WP_223297809.1 | hypothetical protein | - |
| BQ8897_RS01025 (BQ8897_BM110_00198) | - | 144300..144587 (+) | 288 | WP_025196063.1 | hypothetical protein | - |
| BQ8897_RS01030 (BQ8897_BM110_00199) | - | 144589..144843 (+) | 255 | WP_025196062.1 | phage holin | - |
| BQ8897_RS01035 (BQ8897_BM110_00201) | - | 144969..146312 (+) | 1344 | WP_025197090.1 | GH25 family lysozyme | - |
| BQ8897_RS01040 (BQ8897_BM110_00203) | - | 146659..146856 (+) | 198 | WP_017643774.1 | CsbD family protein | - |
| BQ8897_RS01045 (BQ8897_BM110_00204) | prx | 146968..147150 (+) | 183 | WP_000965649.1 | hypothetical protein | Regulator |
| BQ8897_RS01050 (BQ8897_BM110_00205) | - | 147363..148055 (+) | 693 | WP_000049277.1 | histidine phosphatase family protein | - |
| BQ8897_RS01055 (BQ8897_BM110_00206) | - | 148052..148804 (+) | 753 | WP_000739666.1 | M15 family metallopeptidase | - |
| BQ8897_RS01060 (BQ8897_BM110_00207) | - | 148801..149376 (+) | 576 | WP_001231504.1 | glycoside hydrolase family 73 protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.13 Da Isoelectric Point: 4.1954
>NTDB_id=1146131 BQ8897_RS01045 WP_000965649.1 146968..147150(+) (prx) [Streptococcus agalactiae isolate BM110]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1146131 BQ8897_RS01045 WP_000965649.1 146968..147150(+) (prx) [Streptococcus agalactiae isolate BM110]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS8232 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |